DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and CG9673

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster


Alignment Length:264 Identity:85/264 - (32%)
Similarity:134/264 - (50%) Gaps:31/264 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RLLLLVVIVTLGVVQSSRLPAE----------VGSQPHSISLRRNGVHVCGGALIREKWILTAAH 65
            |:.|.:.::..|::.|:....:          .|..|.|.|:|.|..|||.||:|....||||||
  Fly     5 RITLGLGLLIFGLILSAEASPQGRILGGEDVAQGEYPWSASVRYNKAHVCSGAIISTNHILTAAH 69

  Fly    66 CVSLGGGQQSYPAKSYNVRVGSIQRLTGGQLVPLSKIIIHTNYSSSDAVGSNDLALLELETSVVL 130
            ||| ..|.....|.:..||:|:|.:..||.:|.:..:|||.:|.:.    .:|:|:|||:.::|.
  Fly    70 CVS-SVGITPVDASTLAVRLGTINQYAGGSIVNVKSVIIHPSYGNF----LHDIAILELDETLVF 129

  Fly   131 NANTNPI-----------DLATERPAAGSQIIFSGWGSSQVDGSLSHVLQVATRQSLSASDCQTE 184
            :.....|           |:..|.| .|:.:..:|||... ||:.|:..|.|...:||.|.|:.|
  Fly   130 SDRIQDIALPPTTDEETEDVDAELP-NGTPVYVAGWGELS-DGTASYKQQKANYNTLSRSLCEWE 192

  Fly   185 LYLQQEDLLCLSPVDEDFAGLCSGDAGAPASYNNQLV-GIAAFFVSGCGSEQPDGYVDVTQHLEW 248
            .....|.::|||..:.:  |:|.|||||....::::: |:.:|....|||:.||....|:.:|.|
  Fly   193 AGYGYESVVCLSRAEGE--GICRGDAGAAVIDDDKVLRGLTSFNFGPCGSKYPDVATRVSYYLTW 255

  Fly   249 INEN 252
            |..|
  Fly   256 IEAN 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 80/243 (33%)
Tryp_SPc 30..249 CDD:214473 78/240 (33%)
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 78/236 (33%)
Tryp_SPc 29..259 CDD:238113 80/238 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7244
OMA 1 1.010 - - QHG25869
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0004525
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.880

Return to query results.
Submit another query.