DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and CG9676

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster


Alignment Length:252 Identity:97/252 - (38%)
Similarity:140/252 - (55%) Gaps:23/252 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LVVIVTLGV------VQSSRL----PAEVGSQPHSISLRRNGVHVCGGALIREKWILTAAHCVSL 69
            |:|:...||      |...|:    .|..|..||.|||||.|.|.|||::|.:.:::||||||..
  Fly     8 LLVLCAAGVLAQNDSVVEPRIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCVKQ 72

  Fly    70 GGGQQSYPAKSYNVRVGSIQRLTGGQLVPLSKIIIHTNYSSSDAVGSNDLALLELETSVVLNANT 134
            |....  ||....::.||:...:||..||::.:.:|.||:|:    .:|:|:|.|..|:..|:|.
  Fly    73 GNNVA--PANELEIQAGSLLLSSGGVRVPVATVTVHPNYNSN----GHDVAVLRLRNSLTFNSNI 131

  Fly   135 NPIDLATERPAAGSQIIFSGWGSSQVDGSLSHVLQVATRQSLSASDCQTELYLQQ--EDLLC-LS 196
            ..|.||||.|...:.:..||||:....|.:|:.|.....::||...|| :.||:|  |..:| |.
  Fly   132 AAIKLATEDPPNDATVDISGWGAISQRGPISNSLLYVQVKALSRESCQ-KTYLRQLPETTMCLLH 195

  Fly   197 PVDEDFAGLCSGDAGAPASYNNQLVGIAAFFVSGCGSEQPDGYVDVTQHLEWINENA 253
            |.|:   |.|.||:|.||:|..:|||:|:|.:.|||...||||..|::...||.|.|
  Fly   196 PKDK---GACYGDSGGPATYQGKLVGLASFVIGGCGRAAPDGYERVSKLRNWIAEKA 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 89/224 (40%)
Tryp_SPc 30..249 CDD:214473 87/221 (39%)
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 88/227 (39%)
Tryp_SPc 28..248 CDD:238113 89/229 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473219
Domainoid 1 1.000 117 1.000 Domainoid score I5856
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 1 1.000 - - H114140
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D121264at33392
OrthoFinder 1 1.000 - - FOG0004525
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.