DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and Tmprss11g

DIOPT Version :10

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_796136.2 Gene:Tmprss11g / 320454 MGIID:2444058 Length:417 Species:Mus musculus


Alignment Length:112 Identity:21/112 - (18%)
Similarity:38/112 - (33%) Gaps:38/112 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 KCYQRFWETRDQVVFSLIEIMSVLFFVRLYIWKRTSRRLSKVTQIALLDSLIYLFFNVIP----- 225
            |||| :|..:...::..:.:....|.|                   |:|..|..|.:...     
Mouse   228 KCYQ-YWPEQGCWIYGCVRVAMEDFTV-------------------LVDYTIRKFCHAAEGCRPP 272

  Fly   226 -IILYSHFSPTSVKVNYPPITISRNAGSVIESIILWRLLKAKKKVTP 271
             ::...||:      ::|      :.|..:..|.:.:.||..|.|.|
Mouse   273 RLVTQLHFT------SWP------DFGVPLSPIGMLKFLKKVKSVNP 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 14/91 (15%)
Tmprss11gNP_796136.2 SEA 48..146 CDD:460188
Tryp_SPc 186..414 CDD:238113 21/112 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.