DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and CG31780

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster


Alignment Length:259 Identity:70/259 - (27%)
Similarity:110/259 - (42%) Gaps:46/259 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 GVVQSSRLPAEVGSQPHSISLRRNGVHVCGGALIREKWILTAAHCVSLGGGQQSYPAKSYNVRVG 86
            |:.|.:.:|..|     ::...|...:|.|||||....::||..      ..::..|....||.|
  Fly   111 GLAQEAEVPWMV-----ALLDARTSSYVAGGALIAPHVVITARQ------RTENMTASQLVVRAG 164

  Fly    87 SIQRLTGGQL-----VPLSKIIIHTNYSSSDAVGSNDLALLELETSVVLNANTNPIDLATERPAA 146
            .....|..:.     ||:..|:.|..::..:  |:|::||:.|..|:..:.:.|||.:    |:|
  Fly   165 EWDFSTKTEQLPSVDVPIRSIVRHPGFNLEN--GANNVALVFLRRSLTSSRHINPICM----PSA 223

  Fly   147 G-----SQIIFSGWGSSQVDG-SLSHVLQVATRQSLSASDCQTELYLQ-------QEDLLCLSPV 198
            .     |:.||:|||.:..|. |..:||:..:...:....|:.:|.|.       ...|:|..  
  Fly   224 PKNFDFSRCIFTGWGKNSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAG-- 286

  Fly   199 DEDFAGLCSGDAGAP---ASYNN----QLVGIAAFFVSGCG-SEQPDGYVDVTQHLEWINENAV 254
            .|.....|.||.|:|   |..:|    :|.||..|.|. || ...|..|.:|...:|||....|
  Fly   287 GEPGKDSCEGDGGSPLACAIKDNPQRYELAGIVNFGVD-CGLPGVPAVYTNVANVIEWITLTTV 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 67/247 (27%)
Tryp_SPc 30..249 CDD:214473 65/244 (27%)
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 66/250 (26%)
Tryp_SPc 113..344 CDD:238113 66/250 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457591
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.