DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and CG32808

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster


Alignment Length:232 Identity:74/232 - (31%)
Similarity:113/232 - (48%) Gaps:27/232 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GSQPHSISLRR--NGVHVCGGALIREKWILTAAHCVSLGGGQQSYPAKSYNVRVGSIQRL--TGG 94
            |..|..:||||  :|.|.||..|:...|:|||||||.....:|      .:::.|| |.|  ...
  Fly    39 GEFPFVVSLRRAKSGRHSCGATLLNPYWVLTAAHCVRGSSPEQ------LDLQYGS-QMLARNSS 96

  Fly    95 QLVPLSKIIIHTNYSSSDAVGSNDLALLELETSVVLNANTNPIDLATER---PAAGSQIIFSGWG 156
            |:..::.|.:|..|...|.. .||:|||:|..||.|:....|:.|...|   |...|.:: :|||
  Fly    97 QVARVAAIFVHPGYEPEDKY-VNDIALLQLAQSVALSKFVQPVRLPEPRQVTPGNASAVL-AGWG 159

  Fly   157 SSQVDGSLSHVLQVATRQSLSASDC----QTELYLQQEDLLCLSPVDEDFAGLCSGDAGAPASY- 216
            .:...|.:...||....|..|.::|    ||.|:..|   :| :.:.|...|.||||:|.|... 
  Fly   160 LNATGGVVQQHLQKVKLQVFSDTECSERHQTYLHDSQ---IC-AGLPEGGKGQCSGDSGGPLLLI 220

  Fly   217 -NNQLVGIAAFFVSGCGSEQ-PDGYVDVTQHLEWINE 251
             ::..|||.::.:..|.... |..:.:|:.:::||.|
  Fly   221 GSDTQVGIVSWSIKPCARPPFPGVFTEVSAYVDWIVE 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 74/232 (32%)
Tryp_SPc 30..249 CDD:214473 71/228 (31%)
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 71/228 (31%)
Tryp_SPc 30..258 CDD:238113 74/232 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.