DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and CG6041

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster


Alignment Length:275 Identity:76/275 - (27%)
Similarity:124/275 - (45%) Gaps:51/275 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLVVIVTLGVVQSSRL----------PAEVG---------SQPHSISLRRN------GVHVCGGA 53
            :|.:.:.||.:.|...          |..||         |...||.|..|      ..|:|||.
  Fly     7 ILAIALFLGALASGESLSSETAGKIEPKIVGGYDASIEQVSYQVSIRLTANDKKSYGSGHLCGGV 71

  Fly    54 LIREKWILTAAHCVSLGGGQQSYPAKSYNVRVGSIQRLTGGQ----LVPLSKIIIHTNYSSSDAV 114
            :|.::.:.|||||..:...::...|..:.:.:||.. ||...    :..|.::|.|.|| :.||:
  Fly    72 VISQRLVATAAHCCYITDKKKYRTAGEFVLVMGSTY-LTSSTDRTLMYYLQQLITHENY-NPDAL 134

  Fly   115 GSNDLALLELETSVVLNANT-NPIDLATERPAAGSQIIFSGWGSSQVDGSL-SHVLQVATRQSLS 177
             :||:||:.:...:..|..| ..:.|.::..|..:..:.||||..|.:|:. |:.||.||...:|
  Fly   135 -TNDIALMFINGYIPWNWPTVTALALNSQLVATNTDCLISGWGLLQQNGTFSSNTLQAATVPIVS 198

  Fly   178 ASDCQTELYLQQEDLLCLSPVDEDFAG-------LCSGDAGAPASYNNQLVGIAAFFVSGCGSE- 234
            .:.|:    :....:    ||.:..||       .|.||:|.|.|.|..|.||.: :.:||.:. 
  Fly   199 YTTCR----ISYNSI----PVSQVCAGYLSGGVDACQGDSGGPMSCNGMLAGIVS-YGAGCAAPG 254

  Fly   235 QPDGYVDVTQHLEWI 249
            .|..|.:|:.:.:||
  Fly   255 YPGVYTNVSYYYDWI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 72/249 (29%)
Tryp_SPc 30..249 CDD:214473 70/247 (28%)
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 69/246 (28%)
Tryp_SPc 35..272 CDD:238113 71/247 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.