DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and Prtn3

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_038934901.1 Gene:Prtn3 / 314615 RGDID:1304898 Length:422 Species:Rattus norvegicus


Alignment Length:275 Identity:74/275 - (26%)
Similarity:116/275 - (42%) Gaps:57/275 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SPVQSYSHSRLLLLVVIVTLGVVQSSRLPAEVGSQPH------SISLRRN-GVHVCGGALIREKW 59
            ||:........|.|..:...|.||:|::.....::||      |:.|.|: |.|.|||.||..::
  Rat   171 SPIPRSPRLPCLRLAGVRFHGAVQASKIVGGHEARPHSRPYVASLQLSRSPGSHFCGGTLIHPRF 235

  Fly    60 ILTAAHC----------VSLGGGQ--QSYPAKSYNVRVGSIQRLTGGQLVPLSKIIIHTNYSSSD 112
            :||||||          |.||...  .|.|.:         |:.|..|       :...||:..:
  Rat   236 VLTAAHCLQDISWQLVTVVLGAHDLLSSEPEQ---------QKFTITQ-------VFENNYNPEE 284

  Fly   113 AVGSNDLALLELETSVVLNANTNPIDLATERP--AAGSQIIFSGWGSSQVDGSLSHVLQVATR-- 173
            .:  ||:.||:|.....|........|..:..  :.|:|.:..|||            ::.||  
  Rat   285 TL--NDVLLLQLNRPASLGKQVAVASLPQQDQSLSQGTQCLAMGWG------------RLGTRAP 335

  Fly   174 --QSLSASDCQTELYLQQEDLLCLSPVDEDFAGLCSGDAGAPASYNNQLVGIAAFFVSGCGSEQ- 235
              :.|...:.....:|.:|..:| :.|....||:|.||:|.|...|..|.|:.:|.:..|.|.| 
  Rat   336 TPRVLHELNVTVVTFLCREHNVC-TLVPRRAAGICFGDSGGPLICNGILHGVDSFVIRECASLQF 399

  Fly   236 PDGYVDVTQHLEWIN 250
            ||.:..|:.::.||:
  Rat   400 PDFFARVSMYVNWIH 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 66/247 (27%)
Tryp_SPc 30..249 CDD:214473 64/244 (26%)
Prtn3XP_038934901.1 Tryp_SPc 198..416 CDD:238113 66/248 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.