DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and LOC312273

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001101326.1 Gene:LOC312273 / 312273 RGDID:1563848 Length:246 Species:Rattus norvegicus


Alignment Length:257 Identity:78/257 - (30%)
Similarity:123/257 - (47%) Gaps:37/257 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLVVIVTLGVVQSSRLPAE------VG-------SQPHSISLRRNGVHVCGGALIREKWILTAAH 65
            :.:....||.|  :..|.|      ||       |.|:.:||.. |.|:|||:||.::|:|:|||
  Rat     3 ICIFFTLLGTV--AAFPTEDNDDRIVGGYTCQEHSVPYQVSLNA-GSHICGGSLITDQWVLSAAH 64

  Fly    66 CVSLGGGQQSYPAKSYNVRVG--SIQRLTGG-QLVPLSKIIIHTNYSSSDAVGSNDLALLELETS 127
            |.        :|  ...||:|  :|..:.|. |.:..:|:|:|.:|.....  .||:.|::|::.
  Rat    65 CY--------HP--QLQVRLGEHNIYEIEGAEQFIDAAKMILHPDYDKWTV--DNDIMLIKLKSP 117

  Fly   128 VVLNANTNPIDLATERPAAGSQIIFSGWGSSQVDGSLSHVLQVATRQSLSASDCQTELYLQQ--E 190
            ..||:..:.|.|....|.||::.:.||||..:.......|||......||.|.|. :.|.:|  .
  Rat   118 ATLNSKVSTIPLPQYCPTAGTECLVSGWGVLKFGFESPSVLQCLDAPVLSDSVCH-KAYPRQITN 181

  Fly   191 DLLCLSPVDEDFAGLCSGDAGAPASYNNQLVGIAAFFVSGCGSE-QPDGYVDVTQHLEWINE 251
            ::.||..: |.....|..|:|.|...|.::.||.: :..||..| :|..|..|..:|.||::
  Rat   182 NMFCLGFL-EGGKDSCQYDSGGPVVCNGEVQGIVS-WGDGCALEGKPGVYTKVCNYLNWIHQ 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 75/241 (31%)
Tryp_SPc 30..249 CDD:214473 73/237 (31%)
LOC312273NP_001101326.1 Tryp_SPc 25..242 CDD:238113 73/233 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.