DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and Prss38

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_006246600.1 Gene:Prss38 / 287358 RGDID:1565729 Length:380 Species:Rattus norvegicus


Alignment Length:236 Identity:64/236 - (27%)
Similarity:108/236 - (45%) Gaps:36/236 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 PHSISLRRNGVHVCGGALIREKWILTAAHCVSLGGGQQSYPAKSYNVRVGSIQRLTGG----QLV 97
            |..:|:...|.|||||:::...|:||||||.:     :....:::::.|| |..|...    |..
  Rat   126 PWQVSIHYAGFHVCGGSILNAYWVLTAAHCFA-----REKRLQTFDMYVG-ITNLEVANKHTQWF 184

  Fly    98 PLSKIIIHTNYSSSDAVGSNDLALLELETSVVLNANTNPIDLATERPAAGSQII-----FSGWGS 157
            .::::|||..:.....|| .|:||::.::::|.:....||.|    |::...:.     .:|||.
  Rat   185 EINQVIIHPTFEMFHPVG-GDVALVQSKSAIVFSDYVLPICL----PSSNLNLSDLSCWTTGWGM 244

  Fly   158 SQVDGSLSHVLQVATRQSLSASDCQ----TELYLQQEDLLCLSPVDEDFAGLCSGDAGAPASYN- 217
            ....|.....|..|....:....||    ...||..| :||...: ::...:|.||:|:|.... 
  Rat   245 VSPQGETGKDLLEAQLPLIPKFQCQLLYGLTSYLLPE-MLCAGDI-KNMKNVCEGDSGSPLVCKV 307

  Fly   218 NQL---VGIAAFFVSGCGSEQ---PDGYVDVTQHLEWINEN 252
            ||.   :||.::   |.|..|   |..:.:|:..|.||..|
  Rat   308 NQTWLQIGIVSW---GRGCAQPLYPGVFANVSYFLNWIRYN 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 63/234 (27%)
Tryp_SPc 30..249 CDD:214473 61/231 (26%)
Prss38XP_006246600.1 Tryp_SPc 116..343 CDD:238113 62/232 (27%)
Tryp_SPc 116..342 CDD:214473 61/231 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.