DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and Prss34

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001099242.1 Gene:Prss34 / 287140 RGDID:1306667 Length:316 Species:Rattus norvegicus


Alignment Length:261 Identity:82/261 - (31%)
Similarity:131/261 - (50%) Gaps:39/261 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LVVIVTLGVVQSSRLPAEVGSQPHSISLRRNGVHVCGGALIREKWILTAAHCVSLGGGQQSYPAK 79
            ||.||....|.:||.|.:|..:.:::.|.: ..|:|||:||..:|:|||||||.|    :...|.
  Rat    30 LVGIVGGCPVSASRFPWQVSLRFYNMKLSK-WEHICGGSLIHPQWVLTAAHCVEL----KEMEAS 89

  Fly    80 SYNVRVGSIQRLTGGQLVPLSKIIIHTNYSSS-DAVGSNDLALLELETSVVLNANTNPIDLATER 143
            .:.|:||.::.....||:.::|||.|..:|.. .|.|..|:|||:|:::|||:...:|:.|    
  Rat    90 CFRVQVGQLRLYENDQLMKVAKIIRHPKFSEKLSAPGGADIALLKLDSTVVLSERVHPVSL---- 150

  Fly   144 PAAGSQII------FSGWGSSQVDGSL---SHVLQVATRQSLSASDCQTE----------LYLQQ 189
            |||..:|.      .:|||..:....|   .|:.:||. ..:..|||:.:          ..:.:
  Rat   151 PAASQRISSKKTWWVAGWGVIEGHRPLPPPCHLREVAV-PIVGNSDCEQKYRTYSSLDRTTKIIK 214

  Fly   190 EDLLCLSPVDEDFAGLCSGDAGAP--ASYNNQ--LVGIAAFFVSGCG-SEQPDGYVDVTQHLEWI 249
            :|:||......|   .|..|:|.|  ..:|..  .||:.::.: ||| .:.|..|..|..:|.||
  Rat   215 DDMLCAGMEGRD---SCQADSGGPLVCRWNCSWVQVGVVSWGI-GCGLPDFPGVYTRVMSYLSWI 275

  Fly   250 N 250
            :
  Rat   276 H 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 75/246 (30%)
Tryp_SPc 30..249 CDD:214473 73/243 (30%)
Prss34NP_001099242.1 Tryp_SPc 33..276 CDD:238113 79/256 (31%)
Tryp_SPc 33..275 CDD:214473 78/255 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.