DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and Prss29

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_017453326.1 Gene:Prss29 / 287136 RGDID:1305856 Length:279 Species:Rattus norvegicus


Alignment Length:258 Identity:76/258 - (29%)
Similarity:121/258 - (46%) Gaps:40/258 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 VTLGVVQSSRLPAEVGSQPHSISLR------RNGVHVCGGALIREKWILTAAHCVSLGGGQQSYP 77
            |.:|:|..:..|.  |..|..:|||      .:.||:|||::|..:|:||||||:.......|  
  Rat    27 VLVGIVGGNSAPQ--GKWPWQVSLRVYRYNWASWVHICGGSIIHPQWVLTAAHCIHESDADPS-- 87

  Fly    78 AKSYNVRVGSIQRLTGGQLVPLSKIIIHTNYSSSDAVGSNDLALLELETSVVLNANTNPIDLATE 142
              ::.:.:|.:....|.:|:.:|::|||.::..| .:|| |:|||:|..||....|..|:.|:..
  Rat    88 --AFRIYLGQVYLYGGEKLLKVSRVIIHPDFVRS-GLGS-DVALLQLAQSVRSFPNVKPVKLSPA 148

  Fly   143 RPAAGSQII--FSGWGSSQVDGSL--SHVLQVATRQSLSASDCQTELY------------LQQED 191
            ......:.:  .:||||..:..||  .:.||....:.:..:.|: :||            |..:|
  Rat   149 SLEVTKKDVCWVTGWGSVSMHESLPPPYRLQQVQVKIVDNTLCE-KLYRNATRLSNHGQRLILQD 212

  Fly   192 LLCLSPVDEDFAGLCSGDAGAPASYNN----QLVGIAAFFVSGCG-SEQPDGYVDVTQHLEWI 249
            :||......|   .|.||:|.|...|.    .|||:.::.. ||. .:.|..|..|...|.||
  Rat   213 MLCAGSHGRD---SCYGDSGGPLVCNVTGSWTLVGVVSWGY-GCALKDIPGVYARVQFFLPWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 73/247 (30%)
Tryp_SPc 30..249 CDD:214473 71/245 (29%)
Prss29XP_017453326.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346478
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.