DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and Prss3b

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_775150.1 Gene:Prss3b / 286911 RGDID:708437 Length:247 Species:Rattus norvegicus


Alignment Length:257 Identity:75/257 - (29%)
Similarity:128/257 - (49%) Gaps:38/257 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LVVIVTLGVVQSSRLPAE------VG-------SQPHSISLRRNGVHVCGGALIREKWILTAAHC 66
            |:.:..||...:  ||.:      ||       |.|:.:||.. |.|.|||:||..:|:::||||
  Rat     4 LIFLAFLGAAVA--LPLDDDDDKIVGGYTCQKNSLPYQVSLNA-GYHFCGGSLINSQWVVSAAHC 65

  Fly    67 VSLGGGQQSYPAKSYNVRVG--SIQRLTGG-QLVPLSKIIIHTNYSSSDAVGSNDLALLELETSV 128
                     |.:: ..||:|  :|..:.|| |.:..:|||.|.:|:::  ...||:.|::|.:..
  Rat    66 ---------YKSR-IQVRLGEHNIDVVEGGEQFIDAAKIIRHPSYNAN--TFDNDIMLIKLNSPA 118

  Fly   129 VLNANTNPIDLATERPAAGSQIIFSGWGSSQVDG-SLSHVLQVATRQSLSASDCQTELYLQQ--E 190
            .||:..:.:.|.....::|::.:.||||::...| :...:||......||.|.|::. |..:  .
  Rat   119 TLNSRVSTVSLPRSCGSSGTKCLVSGWGNTLSSGTNYPSLLQCLDAPVLSDSSCKSS-YPGKITS 182

  Fly   191 DLLCLSPVDEDFAGLCSGDAGAPASYNNQLVGIAAFFVSGCGSE-QPDGYVDVTQHLEWINE 251
            ::.||..: |.....|.||:|.|...|.||.|:.::.. ||..: :|..|..|..::.||.:
  Rat   183 NMFCLGFL-EGGKDSCQGDSGGPVVCNGQLQGVVSWGY-GCAQKGKPGVYTKVCNYVNWIQQ 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 71/242 (29%)
Tryp_SPc 30..249 CDD:214473 69/238 (29%)
Prss3bNP_775150.1 Tryp_SPc 24..240 CDD:214473 68/231 (29%)
Tryp_SPc 25..243 CDD:238113 70/234 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.