DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and KLK9

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_036447.1 Gene:KLK9 / 284366 HGNCID:6370 Length:250 Species:Homo sapiens


Alignment Length:263 Identity:75/263 - (28%)
Similarity:113/263 - (42%) Gaps:40/263 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RLLLLVVIVTL----GVVQSSRLPAE---VGSQPHSISLRRNGVHVCGGALIREKWILTAAHCVS 68
            :|.||..:::|    |...:..:.||   ..|||....|.......||..||.::|:||||||  
Human     2 KLGLLCALLSLLAGHGWADTRAIGAEECRPNSQPWQAGLFHLTRLFCGATLISDRWLLTAAHC-- 64

  Fly    69 LGGGQQSYPAKSYN-VRVGS--IQRLTG-GQLVPLSKIIIHTNY----SSSDAVGSNDLALLELE 125
                     .|.|. ||:|.  :.:..| .||..::....|..:    |::|  .::|:.|:.|.
Human    65 ---------RKPYLWVRLGEHHLWKWEGPEQLFRVTDFFPHPGFNKDLSAND--HNDDIMLIRLP 118

  Fly   126 TSVVLNANTNPIDLATERPAAGSQIIFSGWGSSQVDGSLSHV-LQVATRQSLSASDCQTELYLQQ 189
            ....|:....|::|:....:.|.|.:.||||:.....:|..| ||.|....|....|........
Human   119 RQARLSPAVQPLNLSQTCVSPGMQCLISGWGAVSSPKALFPVTLQCANISILENKLCHWAYPGHI 183

  Fly   190 EDLLCLSPVDEDFAGLCSGDAGAPASYNNQLVGIAAFFVSGCGSE------QPDGYVDVTQHLEW 248
            .|.:..:.:.|...|.|.||:|.|...|..|.|:    ||| |:|      :|..|..|..:|:|
Human   184 SDSMLCAGLWEGGRGSCQGDSGGPLVCNGTLAGV----VSG-GAEPCSRPRRPAVYTSVCHYLDW 243

  Fly   249 INE 251
            |.|
Human   244 IQE 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 70/240 (29%)
Tryp_SPc 30..249 CDD:214473 67/236 (28%)
KLK9NP_036447.1 Tryp_SPc 24..247 CDD:238113 70/241 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.