DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and TPSG1

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_011520748.1 Gene:TPSG1 / 25823 HGNCID:14134 Length:346 Species:Homo sapiens


Alignment Length:236 Identity:68/236 - (28%)
Similarity:106/236 - (44%) Gaps:25/236 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 AEVGSQPHSISLRRNGVHVCGGALIREKWILTAAHCVSLGGGQQSYPAKSYNVRVGSIQRLTGGQ 95
            |..|:.|...|||...||||||:|:..:|:||||||.|     .|..:..|.|.:|.::......
Human    69 APAGAWPWQASLRLRRVHVCGGSLLSPQWVLTAAHCFS-----GSLNSSDYQVHLGELEITLSPH 128

  Fly    96 LVPLSKIIIHTNYSSSDAVGSNDLALLELETSVVLNANTNPIDL--ATERPAAGSQIIFSGWGSS 158
            ...:.:||:|::.|..... |.|:||:||...|.|::...|:.|  |::....|.:...:|||.:
Human   129 FSTVRQIILHSSPSGQPGT-SGDIALVELSVPVTLSSRILPVCLPEASDDFCPGIRCWVTGWGYT 192

  Fly   159 QVDGSL--SHVLQVATRQSLSASDCQTEL-----YLQQEDLLCL-SPVDEDFAGLCSGDAGAPAS 215
            :....|  .:.|:......:....|:.:.     .:.|.|:||. .|.|     .|..|:|.|..
Human   193 REGEPLPPPYSLREVKVSVVDTETCRRDYPGPGGSILQPDMLCARGPGD-----ACQDDSGGPLV 252

  Fly   216 YNNQLVGIAAFFVS---GCG-SEQPDGYVDVTQHLEWINEN 252
            .......:.|..||   ||| ..:|..|..|..::.||..:
Human   253 CQVNGAWVQAGTVSWGEGCGRPNRPGVYTRVPAYVNWIRRH 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 68/234 (29%)
Tryp_SPc 30..249 CDD:214473 66/231 (29%)
TPSG1XP_011520748.1 Tryp_SPc 62..290 CDD:214473 66/231 (29%)
Tryp_SPc 63..293 CDD:238113 68/234 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152863
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.