DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and Prss2

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_036861.1 Gene:Prss2 / 25052 RGDID:3418 Length:246 Species:Rattus norvegicus


Alignment Length:262 Identity:80/262 - (30%)
Similarity:128/262 - (48%) Gaps:43/262 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RLLLLVVIVTLGVVQSSRLPAE-----VG-------SQPHSISLRRNGVHVCGGALIREKWILTA 63
            |.||.:.:|...|.    .|.:     ||       |.|:.:|| .:|.|.|||:||.::|:::|
  Rat     2 RALLFLALVGAAVA----FPVDDDDKIVGGYTCQENSVPYQVSL-NSGYHFCGGSLINDQWVVSA 61

  Fly    64 AHCVSLGGGQQSYPAKSYNVRVG--SIQRLTGG-QLVPLSKIIIHTNYSSSDAVGSNDLALLELE 125
            |||         |.:: ..||:|  :|..|.|. |.|..:|||.|.|:.....  :||:.|::|.
  Rat    62 AHC---------YKSR-IQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTL--NNDIMLIKLS 114

  Fly   126 TSVVLNANTNPIDLATERPAAGSQIIFSGWGSSQVDG-SLSHVLQVATRQSLSASDCQTELYLQQ 189
            :.|.|||....:.|.:....||:|.:.||||::...| :...:||......|..:||:.. |..:
  Rat   115 SPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEAS-YPGK 178

  Fly   190 --EDLLCLSPVDEDFAGLCSGDAGAPASYNNQLVGIAAFFVSGCGSEQPDG---YVDVTQHLEWI 249
              ::::|:..: |.....|.||:|.|...|.:|.||.::   |.|...||.   |..|..:::||
  Rat   179 ITDNMVCVGFL-EGGKDSCQGDSGGPVVCNGELQGIVSW---GYGCALPDNPGVYTKVCNYVDWI 239

  Fly   250 NE 251
            .:
  Rat   240 QD 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 75/243 (31%)
Tryp_SPc 30..249 CDD:214473 73/239 (31%)
Prss2NP_036861.1 Tryp_SPc 23..239 CDD:214473 72/233 (31%)
Tryp_SPc 24..242 CDD:238113 74/236 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.