DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and Prss38

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001038986.1 Gene:Prss38 / 216797 MGIID:2685095 Length:322 Species:Mus musculus


Alignment Length:251 Identity:69/251 - (27%)
Similarity:113/251 - (45%) Gaps:41/251 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 VVQSSRLPAEVGSQ---PHSISLRRNGVHVCGGALIREKWILTAAHCVSLGGGQQSYPAKSYNVR 84
            |:|...|..|....   |..:||..:|.|:|||:::...|:|:||||...|     ...::|::.
Mouse    51 VLQGKLLGGEFARDRKWPWQVSLHYSGFHICGGSILSAYWVLSAAHCFDRG-----KKLETYDIY 110

  Fly    85 VG-----SIQRLTGGQLVPLSKIIIHTNYSSSDAVGSNDLALLELETSVVLNANTNPIDLATERP 144
            ||     ...|.|  |...:.::|||..:.....:| .|:||::|::::|.:....||.|    |
Mouse   111 VGITNLEKANRHT--QWFEIYQVIIHPTFQMYHPIG-GDVALVQLKSAIVFSDFVLPICL----P 168

  Fly   145 AAGSQII-----FSGWGSSQVDGSLSHVLQVATRQSLSASDCQ----TELYLQQEDLLCLSPVDE 200
            .:...:|     .:|||.....|...:.|..|....:....||    ...||..| :||.:.: :
Mouse   169 PSDLYLINLSCWTTGWGMISPQGETGNELLEAQLPLIPRFQCQLLYGLSSYLLPE-MLCAADI-K 231

  Fly   201 DFAGLCSGDAGAP-ASYNNQL---VGIAAFFVSGCGSEQ---PDGYVDVTQHLEWI 249
            ....:|.||:|:| ....||.   :||.::   |.|..|   |..:.:|:..|.||
Mouse   232 TMKNVCEGDSGSPLVCKQNQTWLQIGIVSW---GRGCAQPLYPGVFANVSYFLSWI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 66/244 (27%)
Tryp_SPc 30..249 CDD:214473 64/242 (26%)
Prss38NP_001038986.1 Tryp_SPc 58..287 CDD:238113 66/244 (27%)
Tryp_SPc 58..284 CDD:214473 64/242 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.