DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and Prtn3

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_035308.2 Gene:Prtn3 / 19152 MGIID:893580 Length:254 Species:Mus musculus


Alignment Length:254 Identity:73/254 - (28%)
Similarity:116/254 - (45%) Gaps:41/254 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLVVIVTLGVVQSSRLPAEVGSQPH------SISLRR-NGVHVCGGALIREKWILTAAHCVSLGG 71
            ||:.:|..|.||:|::.....::||      |:.|.| .|.|.|||.||..:::||||||:    
Mouse    15 LLLALVVGGAVQASKIVGGHEARPHSRPYVASLQLSRFPGSHFCGGTLIHPRFVLTAAHCL---- 75

  Fly    72 GQQSYPAKSYNVRVGSIQRLTG---GQLVPLSKIIIHTNYSSSDAVGSNDLALLELETSVVLNAN 133
              |....:...|.:|:...|:.   .|...:|: :...||:..:.:  ||:.||:|..:..|...
Mouse    76 --QDISWQLVTVVLGAHDLLSSEPEQQKFTISQ-VFQNNYNPEENL--NDVLLLQLNRTASLGKE 135

  Fly   134 TNPIDLATERP--AAGSQIIFSGWGSSQVDGSLSHVLQ-----VATRQSLSASDCQTELYLQQED 191
            .....|..:..  :.|:|.:..|||..........|||     |.|             :|.:|.
Mouse   136 VAVASLPQQDQTLSQGTQCLAMGWGRLGTQAPTPRVLQELNVTVVT-------------FLCREH 187

  Fly   192 LLCLSPVDEDFAGLCSGDAGAPASYNNQLVGIAAFFVSGCGSEQ-PDGYVDVTQHLEWI 249
            .:| :.|....||:|.||:|.|...|..|.|:.:|.:..|.|.| ||.:..|:.:::||
Mouse   188 NVC-TLVPRRAAGICFGDSGGPLICNGILHGVDSFVIRECASLQFPDFFARVSMYVDWI 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 66/238 (28%)
Tryp_SPc 30..249 CDD:214473 64/236 (27%)
Prtn3NP_035308.2 Tryp_SPc 29..245 CDD:214473 64/238 (27%)
Tryp_SPc 30..248 CDD:238113 66/239 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.