DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and LOC1277264

DIOPT Version :10

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_316711.4 Gene:LOC1277264 / 1277264 VectorBaseID:AGAMI1_004236 Length:306 Species:Anopheles gambiae


Alignment Length:65 Identity:18/65 - (27%)
Similarity:25/65 - (38%) Gaps:19/65 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IASNFVLSILFAQTVFHINLYLLFSTFFTKKVCYRPELLLIYCKIAADIC--YSFTVSIMKSYFL 67
            |..||     ||..|.|..:         :|.|.||   :|:....||:|  ..|..::....||
Mosquito   489 IDKNF-----FADKVIHQVI---------QKGCGRP---IIFSSFDADMCTMLRFKQNVFPVMFL 536

  Fly    68  67
            Mosquito   537  536

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 11/40 (28%)
LOC1277264XP_316711.4 Tryp_SPc 60..299 CDD:238113
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.