DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and Prss28

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_444489.2 Gene:Prss28 / 114661 MGIID:2149951 Length:274 Species:Mus musculus


Alignment Length:284 Identity:79/284 - (27%)
Similarity:125/284 - (44%) Gaps:56/284 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RLLLLVVIVTLGVVQSSRLPAEV------------------GSQPHSISLR------RNGVHVCG 51
            |||||    .|..::|:...|.|                  |..|..:|||      .:.||:||
Mouse     3 RLLLL----ALSCLESTVFMASVSISRSKPVGIVGGQCTPPGKWPWQVSLRMYSYEVNSWVHICG 63

  Fly    52 GALIREKWILTAAHCVSLGGGQQSYPAKSYNVRVGSIQRLTGGQLVPLSKIIIHTNYSSSDAVGS 116
            |::|..:||||||||:.   .|.:.|| .|.|:||.:......:|:.:|:||||.:|  :|....
Mouse    64 GSIIHPQWILTAAHCIQ---SQDADPA-VYRVQVGEVYLYKEQELLNISRIIIHPDY--NDVSKR 122

  Fly   117 NDLALLELETSVVLNANTNPIDLATERPAAGS--QIIFSGWGSSQVDGSLS-----HVLQVATRQ 174
            .||||::|...:|.:.|.:|:.|..:.....|  |....|||:......|.     |.:::..:.
Mouse   123 FDLALMQLTALLVTSTNVSPVSLPKDSSTFDSTDQCWLVGWGNLLQRVPLQPPYQLHEVKIPIQD 187

  Fly   175 SLSA-------SDCQTELYLQQEDLLCLSPVDEDFAGLCSGDAGAPA---SYNNQL-VGIAAFFV 228
            :.|.       |..:.:.....:|:||......   |.|.||:|.|.   ..|..: ||:.:..:
Mouse   188 NKSCKRAYRKKSSDEHKAVAIFDDMLCAGTSGR---GPCFGDSGGPLVCWKSNKWIQVGVVSKGI 249

  Fly   229 SGCGSEQPDGYVDVTQHLEWINEN 252
            . |.:..|..:..|...|.||:::
Mouse   250 D-CSNNLPSIFSRVQSSLAWIHQH 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 72/263 (27%)
Tryp_SPc 30..249 CDD:214473 70/260 (27%)
Prss28NP_444489.2 Tryp_SPc 31..272 CDD:238113 70/250 (28%)
Tryp_SPc 31..269 CDD:214473 68/247 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842987
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.