DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and Prss1

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_444473.1 Gene:Prss1 / 114228 MGIID:98839 Length:246 Species:Mus musculus


Alignment Length:268 Identity:81/268 - (30%)
Similarity:127/268 - (47%) Gaps:54/268 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SRLLLLVVI---VTLGVVQSSRLPAEVG-------SQPHSISLRRNGVHVCGGALIREKWILTAA 64
            |.||.|.::   |...|....::   ||       |.|:.:|| .:|.|.|||:||.::|:::||
Mouse     2 SALLFLALVGAAVAFPVDDDDKI---VGGYTCRENSVPYQVSL-NSGYHFCGGSLINDQWVVSAA 62

  Fly    65 HCVSLGGGQQSYPAKSYNVRVG--SIQRLTGG-QLVPLSKIIIHTNYSSSDAVGSNDLALLELET 126
            ||         |..: ..||:|  :|..|.|. |.:..:|||.|.|::....  :||:.|::|.:
Mouse    63 HC---------YKTR-IQVRLGEHNINVLEGNEQFIDAAKIIKHPNFNRKTL--NNDIMLIKLSS 115

  Fly   127 SVVLNANTNPIDLATERPAAGSQIIFSGWGSSQVDG-SLSHVLQVATRQSLSASDCQTELYLQQ- 189
            .|.|||....:.|.:....||:|.:.||||::...| |...:||......|..:||:.. |..: 
Mouse   116 PVTLNARVATVALPSSCAPAGTQCLISGWGNTLSFGVSEPDLLQCLDAPLLPQADCEAS-YPGKI 179

  Fly   190 -EDLLCLSPVDEDFAGL-------CSGDAGAPASYNNQLVGIAAFFVSGCGSEQPDG---YVDVT 243
             .:::|        ||.       |.||:|.|...|.:|.||.::   |.|...||.   |..|.
Mouse   180 TGNMVC--------AGFLEGGKDSCQGDSGGPVVCNGELQGIVSW---GYGCALPDNPGVYTKVC 233

  Fly   244 QHLEWINE 251
            .:::||.:
Mouse   234 NYVDWIQD 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 75/245 (31%)
Tryp_SPc 30..249 CDD:214473 73/241 (30%)
Prss1NP_444473.1 Tryp_SPc 23..239 CDD:214473 73/243 (30%)
Tryp_SPc 24..242 CDD:238113 75/246 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.