DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and si:dkey-32n7.7

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_021335883.1 Gene:si:dkey-32n7.7 / 108191692 ZFINID:ZDB-GENE-121214-179 Length:609 Species:Danio rerio


Alignment Length:264 Identity:70/264 - (26%)
Similarity:106/264 - (40%) Gaps:60/264 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 GVVQSSRLPAEVGSQ-------PHSISLRRNGVHVCGGALIREKWILTAAHCVSLGGGQQS--Y- 76
            |::..:.....||.|       |...||.......|||:||.::|:|:||||.:   ||::  | 
Zfish   298 GIIPVNSSNGTVGGQNSSAVHWPWQASLYWYSGQTCGGSLINKEWVLSAAHCFN---GQRNGFYL 359

  Fly    77 -----PAKSYNVRVGSIQRLTGGQLVPLSKIIIHTNYSSSDAVGSNDLALLELETSVVLNANTNP 136
                 |..........|.|       .:..:|.|..|:.:  ...||:||:.|...:....:..|
Zfish   360 TVILGPKTQNKYDPSRISR-------SVKAVIKHPYYNPN--TNDNDIALVRLSFPITFTDSIRP 415

  Fly   137 IDLATERPAAGSQIIFSGWGSSQV-------DG---------SLSHVLQVATRQSLSASDCQTEL 185
            :.||.|    ||  :|:....|.:       ||         ....|..:..||    .:|...:
Zfish   416 VCLAAE----GS--VFNSDTESWITTWRNISDGVPLPSPKIFQEVEVPVIGNRQ----CNCLYGV 470

  Fly   186 YLQQEDLLCLSPVDEDFAGLCSGDAGAPASYNNQLV----GIAAFFVSGCG-SEQPDGYVDVTQH 245
            ....::::|...:.|. ..||.||:|.|...|...|    ||.: |.|||. ||.|..|..|:::
Zfish   471 GSITDNMICAGLLKEG-KDLCQGDSGGPMVSNQSSVWVQSGIVS-FGSGCAQSEFPGVYTRVSRY 533

  Fly   246 LEWI 249
            .|||
Zfish   534 QEWI 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 69/256 (27%)
Tryp_SPc 30..249 CDD:214473 67/254 (26%)
si:dkey-32n7.7XP_021335883.1 NIDO 4..63 CDD:310601
NIDO 141..272 CDD:322035
Tryp_SPc 309..537 CDD:238113 67/251 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587836
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.