DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and LOC102554637

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_017448472.2 Gene:LOC102554637 / 102554637 RGDID:7618053 Length:246 Species:Rattus norvegicus


Alignment Length:269 Identity:82/269 - (30%)
Similarity:128/269 - (47%) Gaps:57/269 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RLLLLVVIVTLGVVQSSRLPAE-----VG-------SQPHSISLRRNGVHVCGGALIREKWILTA 63
            |.||::|:|...|.    .|.:     ||       |.|:.:|| .:|.|.|||:||.::|:::|
  Rat     2 RALLVLVLVGAAVA----FPVDDDDKIVGGYTCQEHSVPYQVSL-NSGYHYCGGSLINDQWVVSA 61

  Fly    64 AHCVSLGGGQQSYPAKSYNVRVG--SIQRLTGG-QLVPLSKIIIHTNYSSSDAVGSNDLALLELE 125
            |||         |.:: ..||:|  :|..|.|. |.|..:|||.|.|:.....  :||:.|::|.
  Rat    62 AHC---------YKSR-IQVRLGEHNINVLEGDEQFVNAAKIIKHPNFDRKTL--NNDIMLIKLS 114

  Fly   126 TSVVLNANTNPIDLATERPAAGSQIIFSGWGSSQVDG-SLSHVLQVATRQSLSASDCQTELYLQQ 189
            :.|.|||....:.|.:....||:|.:.||||::...| :...:||......|..:||:.. |..:
  Rat   115 SPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSFGVNDPDLLQCLDAPLLPQADCEAS-YPGK 178

  Fly   190 --EDLLCLSPVDEDFAGL-------CSGDAGAPASYNNQLVGIAAFFVSGCGSEQPDG---YVDV 242
              .:::|        ||.       |.||:|.|...|.:|.||.::   |.|...||.   |..|
  Rat   179 ITNNMVC--------AGFLEGGKDSCQGDSGGPVVCNGELQGIVSW---GYGCALPDNPGVYTKV 232

  Fly   243 TQHLEWINE 251
            ..:::||.:
  Rat   233 CNYVDWIQD 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 76/250 (30%)
Tryp_SPc 30..249 CDD:214473 74/246 (30%)
LOC102554637XP_017448472.2 Tryp_SPc 24..242 CDD:238113 75/243 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.