DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and LOC101730924

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_031761513.1 Gene:LOC101730924 / 101730924 -ID:- Length:243 Species:Xenopus tropicalis


Alignment Length:255 Identity:81/255 - (31%)
Similarity:123/255 - (48%) Gaps:36/255 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RLLLLVVIVTLGVVQSSRLPAEVG-------SQPHSISLRRNGVHVCGGALIREKWILTAAHCVS 68
            :||||.|:  ||...:......:|       |.|:.:|| .:|.|.|||:||..:|:::||||  
 Frog     2 KLLLLCVL--LGAAAAFDDDKIIGGATCAKNSVPYIVSL-NSGYHFCGGSLINNQWVVSAAHC-- 61

  Fly    69 LGGGQQSYPAKSYNVRVGSIQ-RLTGG--QLVPLSKIIIHTNYSSSDAVGSNDLALLELETSVVL 130
                   |.| |..||:|... .|:.|  |.:..||:|.|:.|:|...  .||:.|::|.::..|
 Frog    62 -------YKA-SIQVRLGEHNIALSEGTEQFISSSKVIRHSGYNSWTL--DNDIMLIKLSSAASL 116

  Fly   131 NANTNPIDLATERPAAGSQIIFSGWGSSQVDGS-LSHVLQVATRQSLSASDCQT----ELYLQQE 190
            ||..|.:.|.:...|||:..:.||||::...|| ...:||......|:.:.|..    |:   ..
 Frog   117 NAAVNAVALPSGCAAAGTSCLISGWGNTLSSGSNYPDLLQCLYAPILTDAQCNNAYPGEI---TN 178

  Fly   191 DLLCLSPVDEDFAGLCSGDAGAPASYNNQLVGIAAFFVSGCGSEQ-PDGYVDVTQHLEWI 249
            :::||..: |.....|.||:|.|...|.||.|:.::.. ||.... |..|..|..:..||
 Frog   179 NMICLGFL-EGGKDSCQGDSGGPVVCNGQLQGVVSWGY-GCAQRNYPGVYTKVCNYNSWI 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 74/236 (31%)
Tryp_SPc 30..249 CDD:214473 72/234 (31%)
LOC101730924XP_031761513.1 Tryp_SPc 21..239 CDD:238113 74/234 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.