DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and LOC100004427

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_005163955.1 Gene:LOC100004427 / 100004427 -ID:- Length:302 Species:Danio rerio


Alignment Length:255 Identity:67/255 - (26%)
Similarity:106/255 - (41%) Gaps:73/255 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LPAEVGSQP--HSISLRRNGVHVCGGALIREKWILTAAHCVSLGGGQQSYPAKSYNVRVGSIQRL 91
            |.|..||.|  .||:.:..|...|.|:||.|:|:||||.|.                        
Zfish    40 LNATEGSWPWQASINFKSTGQFFCSGSLISERWVLTAASCF------------------------ 80

  Fly    92 TGGQLVPLSKIIIHTNYSSSDAVGSN---------------DLALLELETSVVLNANTNPIDLAT 141
               |.:.:|.::|:....:::  |||               |:||::|.:||.......|:.|| 
Zfish    81 ---QRINVSDVVIYLGRLTTN--GSNPYEIPRTVIQVSVTEDIALVQLSSSVTFTDYIRPVCLA- 139

  Fly   142 ERPAAGSQII------FSGWGS-SQVDGSLSHVLQVATRQSLSASDCQ-----TELYLQQEDLLC 194
               ||||..:      .:|||| |..:..||.:|:......::..:|.     |.|    ::::|
Zfish   140 ---AAGSVFVDGTESWVTGWGSTSSTNVILSDMLKEVEAPIVNNIECSNINGITNL----DNVIC 197

  Fly   195 LSPVDEDFAGLCSGDAGAP--ASYNNQLV--GIAAFFVSGCGSEQ-PDGYVDVTQHLEWI 249
            ...|:|.....|..|.|:|  ....:|.:  |:..|  :.||... |..|..|:::.|||
Zfish   198 AGFVNETGKAPCWEDFGSPLVTRQGSQWIQSGVVVF--TFCGQNGFPTLYARVSEYEEWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 66/254 (26%)
Tryp_SPc 30..249 CDD:214473 64/252 (25%)
LOC100004427XP_005163955.1 Tryp_SPc 35..255 CDD:214473 65/253 (26%)
Tryp_SPc 36..257 CDD:238113 67/255 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587696
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.