DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and si:dkey-16l2.17

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_001341498.1 Gene:si:dkey-16l2.17 / 100001520 ZFINID:ZDB-GENE-141212-262 Length:305 Species:Danio rerio


Alignment Length:248 Identity:63/248 - (25%)
Similarity:104/248 - (41%) Gaps:67/248 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 AEVGSQPHSISLR--RNGVHVCGGALIREKWILTAAHCVSLGGGQQSYP----AKSYNVRVGSIQ 89
            |..||.|..:.::  .|| |||||::|.:.|:|:||||         :|    ..:|.:.:|  :
Zfish    38 ASPGSWPWQVDIQMGSNG-HVCGGSIIAKNWVLSAAHC---------FPNPSEVSAYTLYMG--R 90

  Fly    90 RLTGG-----QLVPLSKIIIHTNYSSSDAVGSNDLALLELETSVVLNANTNPIDL--ATERPAAG 147
            .|..|     ::..:.:::|...|  :|..|..|:||::|...|.......|:.|  |..:..:|
Zfish    91 HLLNGYNQFEKVSYVQRVVIPEGY--TDPQGGRDVALVQLRAPVSWTDRIQPVCLPFADFQFNSG 153

  Fly   148 SQIIFSGWGSSQVDGSLSHVLQVATRQ----SLSASDCQTELYLQQ------------EDLLCLS 196
            :....:|||..|...||:..  .|.|:    .:..|.||   ::.|            .|::| :
Zfish   154 TLCYVTGWGHKQEGVSLTGA--AALREVEVPIIDQSSCQ---FMYQILSSDSSTVDILSDMIC-A 212

  Fly   197 PVDEDFAGLCSGDAGAPASYNNQLV-----------GIAAFFVSGCGSEQPDG 238
            ...|.....|.||:|.|      ||           |:.:|.: ||..:...|
Zfish   213 GYKEGGKDSCQGDSGGP------LVCPVGNGTWIQAGVVSFGL-GCAQKNRPG 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 63/248 (25%)
Tryp_SPc 30..249 CDD:214473 63/248 (25%)
si:dkey-16l2.17XP_001341498.1 Tryp_SPc 32..273 CDD:238113 63/248 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587804
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.