DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and gzm3

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001122022.1 Gene:gzm3 / 100000986 ZFINID:ZDB-GENE-070912-132 Length:253 Species:Danio rerio


Alignment Length:263 Identity:72/263 - (27%)
Similarity:119/263 - (45%) Gaps:37/263 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LLLVVIVTLGVVQSSRLPAEVGSQPHS---ISLRRNGVHVCGGALIREKWILTAAHC-------- 66
            |||:.|...|.:.|..:..:| ::|||   ::..:|....|||.|||:.:|||||||        
Zfish     7 LLLLAISLAGGMDSGIIGGKV-AKPHSRPYMAFIQNKFEACGGMLIRDDYILTAAHCLNNNDRSH 70

  Fly    67 --VSLGGGQQSYPAKSYNVRVGSIQRLTGGQLVPLSKIIIHTNY--SSSDAVGSNDLALLELETS 127
              |.||....|...||.             |.:.:.|.|.|..:  |:::...|.|:.||:|:..
Zfish    71 FEVVLGAHNISKHEKSQ-------------QRIQVKKHIQHPMFLNSNNEKDYSYDIMLLKLKNK 122

  Fly   128 VVLNANTNPIDL--ATERPAAGSQIIFSGWGSSQVDGSL-SHVLQVATRQSLSASDCQT--ELYL 187
            ..:|.....:.|  ..|:.....:...:|||:.:.:|:. |.||:..|.:..:..:|:.  :.:.
Zfish   123 AKINKFVKVLSLPKKNEKLPENVKCSIAGWGTKESNGNKPSDVLEEVTVKLQNNHECERKWQQHF 187

  Fly   188 QQEDLLCLSPVDEDFAGLCSGDAGAPASYNNQLVGIAAFFV-SGCGSEQPDGYVDVTQHLEWINE 251
            ..|.:.|  .|.:.....|.||:|:|...|.:...||::.| ..|....|..:|.::..|.||.:
Zfish   188 NPERMFC--SVSDGKHAFCRGDSGSPLICNTKPQAIASYTVKKDCLHTHPQVFVKISCFLPWIKK 250

  Fly   252 NAV 254
            |.|
Zfish   251 NMV 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 64/242 (26%)
Tryp_SPc 30..249 CDD:214473 62/239 (26%)
gzm3NP_001122022.1 Tryp_SPc 22..251 CDD:238113 64/244 (26%)
Tryp_SPc 22..248 CDD:214473 62/241 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.