DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HRAS and RAS2

DIOPT Version :9

Sequence 1:NP_001123914.1 Gene:HRAS / 3265 HGNCID:5173 Length:189 Species:Homo sapiens
Sequence 2:NP_014301.1 Gene:RAS2 / 855625 SGDID:S000005042 Length:322 Species:Saccharomyces cerevisiae


Alignment Length:177 Identity:108/177 - (61%)
Similarity:130/177 - (73%) Gaps:11/177 - (6%)


- Green bases have known domain annotations that are detailed below.


Human     3 EYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAM 67
            ||||||||.||||||||||||.|:|||||||||||||||||||||.|..:|||||||||||||||
Yeast    10 EYKLVVVGGGGVGKSALTIQLTQSHFVDEYDPTIEDSYRKQVVIDDEVSILDILDTAGQEEYSAM 74

Human    68 RDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLA-ARTVESRQAQ 131
            |:||||.|||||.|::|.:..|.:::..|.:||.||||:|.||:|:||||.||. .:.|..:...
Yeast    75 REQYMRNGEGFLLVYSITSKSSLDELMTYYQQILRVKDTDYVPIVVVGNKSDLENEKQVSYQDGL 139

Human   132 DLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESG 178
            ::|:....|::|||||....||:|||||.|.:|          ||.|
Yeast   140 NMAKQMNAPFLETSAKQAINVEEAFYTLARLVR----------DEGG 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HRASNP_001123914.1 H_N_K_Ras_like 3..164 CDD:133338 104/161 (65%)
Effector region 32..40 7/7 (100%)
Hypervariable region 166..185 3/13 (23%)
RAS2NP_014301.1 small_GTPase 9..172 CDD:197466 104/161 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S22
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000092
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100217
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1068
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.690

Return to query results.
Submit another query.