DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HRAS and hras

DIOPT Version :9

Sequence 1:NP_001123914.1 Gene:HRAS / 3265 HGNCID:5173 Length:189 Species:Homo sapiens
Sequence 2:XP_012816615.1 Gene:hras / 549757 XenbaseID:XB-GENE-479381 Length:199 Species:Xenopus tropicalis


Alignment Length:189 Identity:182/189 - (96%)
Similarity:186/189 - (98%) Gaps:0/189 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     1 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYS 65
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
 Frog    11 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYS 75

Human    66 AMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQA 130
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||.|||||:|||
 Frog    76 AMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLPARTVETRQA 140

Human   131 QDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKCVLS 189
            |||||||||||||||||||||||||||||||||||||||||||||||..||::||||:|
 Frog   141 QDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESEKGCLNCKCVVS 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HRASNP_001123914.1 H_N_K_Ras_like 3..164 CDD:133338 158/160 (99%)
Effector region 32..40 7/7 (100%)
Hypervariable region 166..185 14/18 (78%)
hrasXP_012816615.1 H_N_K_Ras_like 13..174 CDD:133338 158/160 (99%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 317 1.000 Domainoid score I8592
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H55890
Inparanoid 1 1.050 334 1.000 Inparanoid score I10092
NCBI 1 1.000 - -
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1259506at2759
OrthoFinder 1 1.000 - - FOG0000092
OrthoInspector 1 1.000 - - oto148944
Panther 1 1.100 - - LDO PTHR24070
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1068
SonicParanoid 1 1.000 - - X934
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.190

Return to query results.
Submit another query.