DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HRAS and Hras

DIOPT Version :9

Sequence 1:NP_001123914.1 Gene:HRAS / 3265 HGNCID:5173 Length:189 Species:Homo sapiens
Sequence 2:XP_006230597.3 Gene:Hras / 293621 RGDID:2827 Length:290 Species:Rattus norvegicus


Alignment Length:189 Identity:189/189 - (100%)
Similarity:189/189 - (100%) Gaps:0/189 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     1 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYS 65
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat   102 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYS 166

Human    66 AMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQA 130
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat   167 AMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQA 231

Human   131 QDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKCVLS 189
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat   232 QDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKCVLS 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HRASNP_001123914.1 H_N_K_Ras_like 3..164 CDD:133338 160/160 (100%)
Effector region 32..40 7/7 (100%)
Hypervariable region 166..185 18/18 (100%)
HrasXP_006230597.3 H_N_K_Ras_like 104..265 CDD:133338 160/160 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C83682943
Domainoid 1 1.000 320 1.000 Domainoid score I14375
eggNOG 1 0.900 - - E2759_KOG0395
HGNC 1 1.500 - -
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H55890
Inparanoid 1 1.050 383 1.000 Inparanoid score I13476
NCBI 1 1.000 - -
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1259506at2759
OrthoFinder 1 1.000 - - FOG0000092
OrthoInspector 1 1.000 - - oto130202
orthoMCL 1 0.900 - - OOG6_100217
Panther 1 1.100 - - LDO PTHR24070
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X934
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1515.300

Return to query results.
Submit another query.