DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HRAS and ras1

DIOPT Version :9

Sequence 1:NP_001123914.1 Gene:HRAS / 3265 HGNCID:5173 Length:189 Species:Homo sapiens
Sequence 2:NP_593579.1 Gene:ras1 / 2542285 PomBaseID:SPAC17H9.09c Length:219 Species:Schizosaccharomyces pombe


Alignment Length:179 Identity:116/179 - (64%)
Similarity:137/179 - (76%) Gaps:6/179 - (3%)


- Green bases have known domain annotations that are detailed below.


Human     1 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYS 65
            :.||||||||.||||||||||||||:||||||||||||||||:..||||..|||:||||||||||
pombe     6 LREYKLVVVGDGGVGKSALTIQLIQSHFVDEYDPTIEDSYRKKCEIDGEGALLDVLDTAGQEEYS 70

Human    66 AMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESR-Q 129
            |||:||||||||||.|:.|.:..||::|..:.:||.||||.|..|:|||.|||||.|..|.|| :
pombe    71 AMREQYMRTGEGFLLVYNITSRSSFDEISTFYQQILRVKDKDTFPVVLVANKCDLEAERVVSRAE 135

Human   130 AQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESG 178
            .:.||:|....|:|||||.|..||:|||:|||.||::     |..:|.|
pombe   136 GEQLAKSMHCLYVETSAKLRLNVEEAFYSLVRTIRRY-----NKSEEKG 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HRASNP_001123914.1 H_N_K_Ras_like 3..164 CDD:133338 111/161 (69%)
Effector region 32..40 7/7 (100%)
Hypervariable region 166..185 3/13 (23%)
ras1NP_593579.1 small_GTPase 7..172 CDD:197466 113/164 (69%)
H_N_K_Ras_like 8..170 CDD:133338 111/161 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000092
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100217
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1068
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.