DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HRAS and let-60

DIOPT Version :9

Sequence 1:NP_001123914.1 Gene:HRAS / 3265 HGNCID:5173 Length:189 Species:Homo sapiens
Sequence 2:NP_502213.3 Gene:let-60 / 178104 WormBaseID:WBGene00002335 Length:184 Species:Caenorhabditis elegans


Alignment Length:181 Identity:139/181 - (76%)
Similarity:157/181 - (86%) Gaps:0/181 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     1 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYS 65
            ||||||||||.||||||||||||||||||:|||||||||||||||||||||||||||||||||||
 Worm     1 MTEYKLVVVGDGGVGKSALTIQLIQNHFVEEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYS 65

Human    66 AMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQA 130
            ||||||||||||||.|||:|..||||::..|||||:|||||||||||||||||||::|:|:.|..
 Worm    66 AMRDQYMRTGEGFLLVFAVNEAKSFENVANYREQIRRVKDSDDVPMVLVGNKCDLSSRSVDFRTV 130

Human   131 QDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGC 181
            .:.|:.||||.::||||||.||::||||||||||:|:.|..|...:....|
 Worm   131 SETAKGYGIPNVDTSAKTRMGVDEAFYTLVREIRKHRERHDNNKPQKKKKC 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HRASNP_001123914.1 H_N_K_Ras_like 3..164 CDD:133338 131/160 (82%)
Effector region 32..40 7/7 (100%)
Hypervariable region 166..185 4/16 (25%)
let-60NP_502213.3 H_N_K_Ras_like 3..164 CDD:133338 131/160 (82%)
small_GTPase 16..166 CDD:197466 121/149 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C161454081
Domainoid 1 1.000 269 1.000 Domainoid score I1094
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 284 1.000 Inparanoid score I1975
Isobase 1 0.950 - 0 Normalized mean entropy S22
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1259506at2759
OrthoFinder 1 1.000 - - FOG0000092
OrthoInspector 1 1.000 - - otm15429
orthoMCL 1 0.900 - - OOG6_100217
Panther 1 1.100 - - LDO PTHR24070
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1068
SonicParanoid 1 1.000 - - X934
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.780

Return to query results.
Submit another query.