DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and 1810009J06Rik

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_076196.1 Gene:1810009J06Rik / 73626 MGIID:1920876 Length:247 Species:Mus musculus


Alignment Length:252 Identity:66/252 - (26%)
Similarity:113/252 - (44%) Gaps:31/252 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GLILSAEASPQGRILGGEDVAQGEYPWSASVRYNKAHVCSGAIISTNHILTAAHCVSSVGITPVD 80
            |..::..|:...:|:||....:...|:..|:....:|.|.|::||...:|:||||..        
Mouse    11 GAAVALPANSDDKIVGGYTCPKHSVPYQVSLNDGISHQCGGSLISDQWVLSAAHCYK-------- 67

  Fly    81 ASTLAVRLG--TINQYAGG-SIVNVKSVIIHPSYGNFL--HDIAILELDETLVFSDRIQDIALPP 140
             ..|.||||  .|:...|| ..::.:.:|.||.|....  :||.:::|....:.:.::..::|| 
Mouse    68 -RRLQVRLGEHNIDVLEGGEQFIDAEKIIRHPDYNKDTVDNDIMLIKLKSPAILNSQVSTVSLP- 130

  Fly   141 TTDEETEDVDAELPNGTPVYVAGWGELSDGTASYKQ--QKANYNTLSRSLCEWE-AGYGYESVVC 202
               ......:|:      ..|:|||........|..  |......||.|.|:.. .|....::.|
Mouse   131 ---RSCASTNAQ------CLVSGWGNTVSIGGKYPALLQCLEAPVLSASSCKKSYPGQITSNMFC 186

  Fly   203 LSRAE-GEGICRGDAGAAVIDDDKVLRGLTSFNFGPCGSK-YPDVATRVSYYLTWIE 257
            |...| |:..|.||:|..|:.:.:: :|:.|:. ..|..: .|.|.|:|..||:||:
Mouse   187 LGFLEGGKDSCDGDSGGPVVCNGEI-QGIVSWG-SVCAMRGKPGVYTKVCNYLSWIQ 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 62/237 (26%)
Tryp_SPc 29..259 CDD:238113 64/239 (27%)
1810009J06RikNP_076196.1 Tryp_SPc 23..240 CDD:214473 62/237 (26%)
Tryp_SPc 24..243 CDD:238113 64/239 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.