DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and Prss59

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001348859.1 Gene:Prss59 / 73481 MGIID:1920731 Length:251 Species:Mus musculus


Alignment Length:274 Identity:53/274 - (19%)
Similarity:92/274 - (33%) Gaps:66/274 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IFGLILSAEASPQGRILGGEDVAQGEYPWSASVRY-----NKAHVCSGAIISTNHILTAAHCVSS 73
            ||.|:..|.|:....:|...:.::...|.:.:|.|     :....|.|.:|....:||||||   
Mouse     6 IFTLLSLAVANTPKAVLKEYNNSEEYLPENFNVPYMVYLQSSPEPCVGTLIDPQWVLTAAHC--- 67

  Fly    74 VGITPVDASTLAVRLGTIN---QYAGGSIVNVKSVIIHPSYGNFL--HDIAILELDETLVFSDRI 133
                   :....:|||...   :.....|.|....::||::...|  :|:.:::|......:..:
Mouse    68 -------SLPTKIRLGVYRPNIKNEKEQICNYSFTVVHPNFDAKLLKNDLMLIKLSYPATINMYV 125

  Fly   134 QDIAL---PPTTDEETEDVDAELPNGTPVYVAGWGELSDGTASYKQQKANYNTLS-RSLCEWEAG 194
            ..||:   |...:|     ...:|..|      |.              ||..|| ..:..|...
Mouse   126 GTIAIAMEPMAFNE-----SCFIPTWT------WN--------------NYKNLSDPDILTWINE 165

  Fly   195 YGYESVVCLSRAEGEG-------ICRGDAGAAVIDDDKV----------LRGLTSFNFGPCGSKY 242
            |......||.....:.       :|.|.:..|:....:|          :.|:.|:......:..
Mouse   166 YSLSPSDCLDTLHQQKQETRINIMCIGHSLNAMSATKEVSAAPAICSGRVHGILSWGKASVANGS 230

  Fly   243 PDVATRVSYYLTWI 256
            ....|.:..|..||
Mouse   231 KGFFTEIHPYARWI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 46/258 (18%)
Tryp_SPc 29..259 CDD:238113 48/259 (19%)
Prss59NP_001348859.1 Tryp_SPc 37..244 CDD:389826 44/241 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837566
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.