DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and Prss54

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:XP_006531428.1 Gene:Prss54 / 70993 MGIID:1918243 Length:429 Species:Mus musculus


Alignment Length:304 Identity:71/304 - (23%)
Similarity:121/304 - (39%) Gaps:89/304 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADPRITLGLGLLIFGLILSAEASPQGRILGGED-----------VAQGEYPWSASVRYNK-AHV 53
            ||:.|     |:|:..|.:|..:|   .|.|.:.           |:..|:||..|::..: .|:
Mouse    47 MAEMR-----GMLLMLLYISHSSS---AICGIQKATIADKLKENLVSSTEFPWVVSIQDKQYTHL 103

  Fly    54 CSGAIISTNHILTAA-------HCVSSVGITPVDASTLAVRLGTINQYAGGSIVNVKSVIIHPSY 111
            ..|.|:|...||:.|       ..::.|||:.:|.     |.....:|      :|.::|.|.::
Mouse   104 AFGCILSEFWILSTASALQHRKEVIAVVGISNMDP-----RKTDHREY------SVNTIIPHENF 157

  Fly   112 GNFL--HDIAILELDETLVFSDRIQDIAL-------PPTTDEETEDVDAELPNGTPVYVAGWGEL 167
            .|..  ::||:|:.:..:.|:|.:|.|..       ||.           |.|   .:||||...
Mouse   158 DNVSMGNNIALLKTESAMHFNDLVQAICFLGKKLHKPPA-----------LKN---CWVAGWNPT 208

  Fly   168 SDGTASYKQQKANYNTLS---------RSLCEWEAGYGYESVVCLSRA-EGEGICRGDAGAAVID 222
            |        ...|:.|:|         ..:|....   ::...|.|.. |...:|.|:.|:.::.
Mouse   209 S--------ATGNHMTMSILRRISVKDIEVCPLRR---HQKTECASHTKEPNNVCLGEPGSPMMC 262

  Fly   223 DDK-----VLRGLTSFNFGPCGSKYPDVATRVSYYLTWIEANTQ 261
            ..|     :||||.::....|...:  :.|.|:.|..||.|.|:
Mouse   263 QAKKLDLWILRGLLAYGGDSCPGLF--LYTSVADYSDWITAKTR 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 59/270 (22%)
Tryp_SPc 29..259 CDD:238113 61/272 (22%)
Prss54XP_006531428.1 Tryp_SPc 88..299 CDD:238113 56/248 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837549
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.