DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and Klk12

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_081373.1 Gene:Klk12 / 69511 MGIID:1916761 Length:247 Species:Mus musculus


Alignment Length:259 Identity:72/259 - (27%)
Similarity:115/259 - (44%) Gaps:44/259 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LILSAEASPQG---RILGGEDVAQGEYPWSASVRYNKAHVCSGAIISTNHILTAAHC----VSSV 74
            |:|.|....|.   :|..|.:..:...||...:.:.|...|.|.::....:||||||    |..:
Mouse     7 LLLCAVGLSQADREKIYNGVECVKNSQPWQVGLFHGKYLRCGGVLVDRKWVLTAAHCRDKYVVRL 71

  Fly    75 G---ITPVDASTLAVRLGTINQYAGGSIVNVKSVIIHPS----YGNFLHDIAILELDETLVFSDR 132
            |   :|.:| .|..:|..|.:             |.|||    |.|..||:.:|.|:..:..:..
Mouse    72 GEHSLTKLD-WTEQLRHTTFS-------------ITHPSYQGAYQNHEHDLRLLRLNRPIHLTRA 122

  Fly   133 IQDIALPPTTDEETEDVDAELPNGTPVYVAGWGELSDGTASY--KQQKANYNTLSRSLCEWE-AG 194
            ::.:|||.:.          :..|...:|:|||..:.....:  :.|..|.:|:|...|... .|
Mouse   123 VRPVALPSSC----------VTTGAMCHVSGWGTTNKPWDPFPDRLQCLNLSTVSNETCRAVFPG 177

  Fly   195 YGYESVVCLSRAEGEGICRGDAGAAVIDDDKVLRGLTSF-NFGPCGSK-YPDVATRVSYYLTWI 256
            ...|:::|.....|:..|:||:|..::... ||:||.|: :.||||.| .|.|.|:|..|..||
Mouse   178 RVTENMLCAGGEAGKDACQGDSGGPLVCGG-VLQGLVSWGSVGPCGQKGIPGVYTKVCKYTDWI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 66/243 (27%)
Tryp_SPc 29..259 CDD:238113 68/244 (28%)
Klk12NP_081373.1 Tryp_SPc 21..240 CDD:214473 66/243 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837545
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BGUI
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.