DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and Klk5

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_081082.1 Gene:Klk5 / 68668 MGIID:1915918 Length:293 Species:Mus musculus


Alignment Length:243 Identity:68/243 - (27%)
Similarity:109/243 - (44%) Gaps:35/243 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 RILGGEDVAQGEYPWSASVRY--NKAHVCSGAIISTNHILTAAHCVSSVGITPVDASTLAVRLGT 90
            ||:.|.|..:...||..::..  ||.: |...:||...:||||||...|         ..:|||.
Mouse    67 RIVNGSDCQKDAQPWQGALLLGPNKLY-CGAVLISPQWLLTAAHCRKPV---------FRIRLGH 121

  Fly    91 INQ---YAGGS--IVNVKSVIIHPSYGNFLH--DIAILELDETLVFSDRIQDIALPPTTDEETED 148
            .:.   |..|.  ...:|| |.||.|.:..|  |:.:::::..:..|..::.:.:  ..|..|| 
Mouse   122 HSMSPVYESGQQMFQGIKS-IPHPGYSHPGHSNDLMLIKMNRKIRDSHSVKPVEI--ACDCATE- 182

  Fly   149 VDAELPNGTPVYVAGWGELSDGTASYKQ--QKANYNTLSRSLCEWE-AGYGYESVVCLSRAEGEG 210
                   ||...|:|||..|....::.:  |..|...||...|:.. .|...:::.|....||..
Mouse   183 -------GTRCMVSGWGTTSSSHNNFPKVLQCLNITVLSEERCKNSYPGQIDKTMFCAGDEEGRD 240

  Fly   211 ICRGDAGAAVIDDDKVLRGLTSFNFGPCGSK-YPDVATRVSYYLTWIE 257
            .|:||:|..|:.:.| |:||.|:...||..: .|.|.|.:..::.||:
Mouse   241 SCQGDSGGPVVCNGK-LQGLVSWGDFPCAQRNRPGVYTNLCEFVKWIK 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 66/240 (28%)
Tryp_SPc 29..259 CDD:238113 67/242 (28%)
Klk5NP_081082.1 Tryp_SPc 67..286 CDD:214473 66/240 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837556
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.