DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and zgc:123295

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001032651.1 Gene:zgc:123295 / 641564 ZFINID:ZDB-GENE-051127-11 Length:310 Species:Danio rerio


Alignment Length:254 Identity:76/254 - (29%)
Similarity:122/254 - (48%) Gaps:41/254 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 RILGGEDVAQGEYPWSASVR---YNKAHVCSGAIISTNHILTAAHCV-SSVGITPVDASTLAVRL 88
            :|:||::...|.:||..|::   |. .|.|.|::|:.:.:|:||||. .|:|       |:.|:|
Zfish    35 KIVGGQNAGAGSWPWQVSLQSPTYG-GHFCGGSLINKDWVLSAAHCFQDSIG-------TIMVKL 91

  Fly    89 GTINQYAGGS-----IVNVKSVIIHPSYGNFL--HDIAILELDETLVFSDRIQDIALPPTTDEET 146
            |..:|  .||     ...|..||.||:|.|..  :|||:::||.::.|:|.|:.:.|....:...
Zfish    92 GLQSQ--SGSNPYQITKTVVQVINHPNYNNPSNDNDIALVKLDSSVTFNDYIEPVCLAAAGNTYA 154

  Fly   147 EDVDAELPNGTPVYVAGWGELSDGTASYKQ--QKANYNTLSRSLCEWEAGYGYE---SVVCLSRA 206
            .        ||..:|.|||:||........  |:.....:|.|.|  :..|..|   :::|....
Zfish   155 A--------GTLSWVTGWGKLSSAANQIPDILQEVEIPIVSHSDC--KRAYPGEITSNMICAGLL 209

  Fly   207 E--GEGICRGDAGAAVID---DDKVLRGLTSFNFGPCGSKYPDVATRVSYYLTWIEANT 260
            :  |:..|:||:|..::.   ...:..|:.||..|.....||.|..|||.|..||.::|
Zfish   210 DQGGKDSCQGDSGGPMVSRNGSQWIQSGIVSFGRGCAEPGYPGVYARVSQYQDWITSST 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 73/248 (29%)
Tryp_SPc 29..259 CDD:238113 75/250 (30%)
zgc:123295NP_001032651.1 Tryp_SPc 35..264 CDD:214473 73/248 (29%)
Tryp_SPc 36..264 CDD:238113 73/247 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.