DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and CG18735

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster


Alignment Length:250 Identity:72/250 - (28%)
Similarity:112/250 - (44%) Gaps:31/250 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 RILGGEDVAQGEYPWSASVRYNKAHVCSGAIISTNHILTAAHCVSSVGITPVDASTLAVRLGTIN 92
            ||:||::....||||...:.:.....|..::::..:.|||||||:.     .....:.|||...|
  Fly    82 RIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNG-----FYHRLITVRLLEHN 141

  Fly    93 -QYAGGSIVN--VKSVIIHPSYG--NFLHDIAILELDETLVFSDRIQDIALPPTTDEETEDVDAE 152
             |.:...||:  |..|:|||.|.  ||..|||::..:|.:.....:..:.:|..::...      
  Fly   142 RQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENYA------ 200

  Fly   153 LPNGTPVYVAGWGELSD-GTASYKQQKANYNTLSRSLCEWEAGYG----YESVVCLSRAE--GEG 210
               |....|.|||.||: |..|...|:.....||:..|. .:.||    .::::|....|  |:.
  Fly   201 ---GQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECR-NSNYGESKITDNMICAGYVEQGGKD 261

  Fly   211 ICRGDAGAAV----IDDDKVLRGLTSFNFGPCGSKYPDVATRVSYYLTWIEANTQ 261
            .|:||:|..:    ..|...|.|:.|:..|......|.|.|||..:..||..||:
  Fly   262 SCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAENTR 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 68/243 (28%)
Tryp_SPc 29..259 CDD:238113 69/245 (28%)
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 68/243 (28%)
Tryp_SPc 83..314 CDD:238113 69/245 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.