Sequence 1: | NP_001285346.1 | Gene: | CG9673 / 32649 | FlyBaseID: | FBgn0030775 | Length: | 261 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021335658.1 | Gene: | si:dkey-33m11.7 / 565163 | ZFINID: | ZDB-GENE-141216-115 | Length: | 214 | Species: | Danio rerio |
Alignment Length: | 199 | Identity: | 47/199 - (23%) |
---|---|---|---|
Similarity: | 79/199 - (39%) | Gaps: | 40/199 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 83 TLAVRLGTINQYAGGSIVNVKSVIIHPSYGNFLH--DIAILELDETLVFSDRIQDIALPPTTDEE 145
Fly 146 TEDVDAELPNGTPVYVAGWGEL--SDGTASYKQQKANYNTLSRSLCEWEAGYG---YESVVCLSR 205
Fly 206 AEGEG----------------ICRGDAGAAVIDDDKVLRGLTSFNFGPCGS-KYPDVATRVSYYL 253
Fly 254 TWIE 257 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG9673 | NP_001285346.1 | Tryp_SPc | 28..256 | CDD:214473 | 45/196 (23%) |
Tryp_SPc | 29..259 | CDD:238113 | 47/199 (24%) | ||
si:dkey-33m11.7 | XP_021335658.1 | Tryp_SPc | <2..196 | CDD:238113 | 47/199 (24%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D469244at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |