DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and si:dkey-33m11.7

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:XP_021335658.1 Gene:si:dkey-33m11.7 / 565163 ZFINID:ZDB-GENE-141216-115 Length:214 Species:Danio rerio


Alignment Length:199 Identity:47/199 - (23%)
Similarity:79/199 - (39%) Gaps:40/199 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 TLAVRLGTINQYAGGSIVNVKSVIIHPSYGNFLH--DIAILELDETLVFSDRIQDIALPPTTDEE 145
            ||....|| .||:     ....:|.||.|....:  ||.:::|...:..:   :.::|.|...:.
Zfish    12 TLGANEGT-EQYS-----KPLMLIPHPLYNRSTNNADIMLIKLSAPIELN---RYVSLAPLPKQN 67

  Fly   146 TEDVDAELPNGTPVYVAGWGEL--SDGTASYKQQKANYNTLSRSLCEWEAGYG---YESVVCLSR 205
            |     .|..|....|:|||..  |.|......:......:|...|...:.:.   ..:::|...
Zfish    68 T-----GLLAGRMCRVSGWGSTSHSGGLIPLTLRTVRLPIVSTFKCNSSSSFSGNITANMICAGS 127

  Fly   206 AEGEG----------------ICRGDAGAAVIDDDKVLRGLTSFNFGPCGS-KYPDVATRVSYYL 253
            :.|..                :|:||:|..::.|.:|. ||.|:..| ||. ::|.|.|.||.:.
Zfish   128 STGGKDACKNSTQYLCHLIVYLCQGDSGGPLVCDGRVY-GLVSWGNG-CGDPRFPGVYTAVSRFR 190

  Fly   254 TWIE 257
            .||:
Zfish   191 RWID 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 45/196 (23%)
Tryp_SPc 29..259 CDD:238113 47/199 (24%)
si:dkey-33m11.7XP_021335658.1 Tryp_SPc <2..196 CDD:238113 47/199 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.