DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and si:dkey-33m11.8

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:XP_693464.3 Gene:si:dkey-33m11.8 / 565078 ZFINID:ZDB-GENE-141215-49 Length:251 Species:Danio rerio


Alignment Length:264 Identity:70/264 - (26%)
Similarity:117/264 - (44%) Gaps:50/264 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLIFGLILSAEASPQGRILGGEDVAQGEYPWSASVRYNKAHVCSGAIISTNHILTAAHC-----V 71
            |||..::   :.|.|.||:||::|......:.|||:||..|.|.|.:|....:::||||     :
Zfish    10 LLIVSML---QGSKQQRIIGGQEVQPYSIKYQASVQYNNYHYCGGTLIHPQWVVSAAHCWRPSYL 71

  Fly    72 SSVGITPVDASTLAVRLGTINQYAGGSIVNVKSVIIH--PSYGNFLHDIAILELDETLVFSDRIQ 134
            ..|.::..|.|.:.         ....:.||...::|  .:|..|..||.:|:|::....|..||
Zfish    72 IKVVLSEHDLSKIE---------GFERVFNVSKALVHYMYNYRTFDSDIMLLKLEKPAELSATIQ 127

  Fly   135 DIALPPTTDEETEDVDAELPNGTPVYVAGWGELSDGTASYKQQKANYNTLSRSL-------CEWE 192
            ...||.:.        ..|..||...|:|||.    |..|...   .:.:.|::       |:: 
Zfish   128 PAVLPVSV--------PALQGGTVCIVSGWGV----TQVYSYY---LSPVLRAVDVQIIPQCQY- 176

  Fly   193 AGYGY----ESVVCL-SRAEGEGICRGDAGAAVIDDDKVLRGLTSFNFGPCGSKYPDVATRVSYY 252
              |.|    :::||. |...|:..|:||:|..:|.:. ...|:.|:......:.:|.|.|:|..|
Zfish   177 --YYYYRITDNMVCAGSPLGGKDSCQGDSGGPLICNG-YFEGIVSWGISCANAYFPGVYTKVRNY 238

  Fly   253 LTWI 256
            :.|:
Zfish   239 IPWM 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 64/246 (26%)
Tryp_SPc 29..259 CDD:238113 64/247 (26%)
si:dkey-33m11.8XP_693464.3 Tryp_SPc 23..241 CDD:214473 64/245 (26%)
Tryp_SPc 24..241 CDD:238113 63/244 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.