DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and PRSS3

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:XP_011516267.1 Gene:PRSS3 / 5646 HGNCID:9486 Length:333 Species:Homo sapiens


Alignment Length:239 Identity:63/239 - (26%)
Similarity:106/239 - (44%) Gaps:30/239 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 RILGGEDVAQGEYPWSASVRYNKAHVCSGAIISTNHILTAAHCVSSVGITPVDASTLAVRLG--T 90
            :|:||....:...|:..|:. :.:|.|.|::||...:::||||..         :.:.||||  .
Human   109 KIVGGYTCEENSLPYQVSLN-SGSHFCGGSLISEQWVVSAAHCYK---------TRIQVRLGEHN 163

  Fly    91 INQYAGG-SIVNVKSVIIHPSYG--NFLHDIAILELDETLVFSDRIQDIALPPTTDEETEDVDAE 152
            |....|. ..:|...:|.||.|.  ...:||.:::|....|.:.|:..|:||.|....       
Human   164 IKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTTPPAA------- 221

  Fly   153 LPNGTPVYVAGWGELSDGTASYKQQKANYNTLSRSLCEWEAGYG---YESVVCLSRAE-GEGICR 213
               ||...::|||......|.|..:....:....:..|.:|.|.   ..|:.|:...| |:..|:
Human   222 ---GTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQ 283

  Fly   214 GDAGAAVIDDDKVLRGLTSFNFGPCGSKYPDVATRVSYYLTWIE 257
            .|:|..|:.:.: |:|:.|:..|......|.|.|:|..|:.||:
Human   284 RDSGGPVVCNGQ-LQGVVSWGHGCAWKNRPGVYTKVYNYVDWIK 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 61/236 (26%)
Tryp_SPc 29..259 CDD:238113 63/238 (26%)
PRSS3XP_011516267.1 Tryp_SPc 109..325 CDD:214473 61/236 (26%)
Tryp_SPc 110..328 CDD:238113 63/238 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.