DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and PRSS1

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:XP_011514713.1 Gene:PRSS1 / 5644 HGNCID:9475 Length:472 Species:Homo sapiens


Alignment Length:266 Identity:75/266 - (28%)
Similarity:125/266 - (46%) Gaps:44/266 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLIFGLILSAEASP---QGRILGGEDVAQGEYPWSASVRYNKAHVCSGAIISTNHILTAAHCVSS 73
            |||...:.:|.|:|   ..:|:||.:..:...|:..|:. :..|.|.|::|:...:::|.||.. 
Human   229 LLILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSLN-SGYHFCGGSLINEQWVVSAGHCYK- 291

  Fly    74 VGITPVDASTLAVRLGTIN-QYAGGS--IVNVKSVIIHPSYG--NFLHDIAILELDETLVFSDRI 133
                    |.:.||||..| :...|:  .:|...:|.||.|.  ...:||.:::|....|.:.|:
Human   292 --------SRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVINARV 348

  Fly   134 QDIAL---PPTTDEETEDVDAELPNGTPVYVAGWGELSDGTASY--KQQKANYNTLSRSLCEWEA 193
            ..|:|   ||.|             ||...::|||..:...|.|  :.|..:...||::.|  ||
Human   349 STISLPTAPPAT-------------GTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKC--EA 398

  Fly   194 GYG---YESVVCLSRAE-GEGICRGDAGAAVIDDDKVLRGLTSFNFGPCGSKYPDVATRVSYYLT 254
            .|.   ..::.|:...| |:..|:||:|..|:.:.: |:|:.|:..|......|.|.|:|..|:.
Human   399 SYPGKITSNMFCVGFLEGGKDSCQGDSGGPVVCNGQ-LQGVVSWGDGCAQKNKPGVYTKVYNYVK 462

  Fly   255 WIEANT 260
            ||: ||
Human   463 WIK-NT 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 65/241 (27%)
Tryp_SPc 29..259 CDD:238113 67/243 (28%)
PRSS1XP_011514713.1 Ig 19..119 CDD:299845
IG_like 29..113 CDD:214653
Tryp_SPc 248..464 CDD:214473 65/241 (27%)
Tryp_SPc 249..467 CDD:238113 67/244 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.