DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and KLK15

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_059979.2 Gene:KLK15 / 55554 HGNCID:20453 Length:256 Species:Homo sapiens


Alignment Length:272 Identity:77/272 - (28%)
Similarity:125/272 - (45%) Gaps:53/272 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLIFGLILSAEASPQG-RILGGEDVAQGEYPWSASV----RYNKAHVCSGAIISTNHILTAAHCV 71
            ||....:|::.|:..| ::|.|::.|....||..::    |:|    |..::||.:.:|:||||.
Human     4 LLTLSFLLASTAAQDGDKLLEGDECAPHSQPWQVALYERGRFN----CGASLISPHWVLSAAHCQ 64

  Fly    72 SSVGITPVDASTLAVRLG--TINQYAGGSIVNVKS-VIIHPSYGNFLH--DIAILELDETLVFSD 131
            |..         :.||||  .:.:..|...:...| ||.||.|....|  ||.:|.|.:....:.
Human    65 SRF---------MRVRLGEHNLRKRDGPEQLRTTSRVIPHPRYEARSHRNDIMLLRLVQPARLNP 120

  Fly   132 RIQDIALPPTTDEETEDVDAELPN-GTPVYVAGWGELS---DGTASYKQQK---------ANYNT 183
            :::...||           ...|: |....|:|||.:|   .|||...:.:         ||.:.
Human   121 QVRPAVLP-----------TRCPHPGEACVVSGWGLVSHNEPGTAGSPRSQVSLPDTLHCANISI 174

  Fly   184 LSRSLCEWE-AGYGYESVVCLSRAEGEGI--CRGDAGAAVIDDDKVLRGLTSFNFGPC-GSKYPD 244
            :|.:.|:.. .|....::|| :.|||.|.  |.||:|..::... :|:|:.|:...|| .:..|.
Human   175 ISDTSCDKSYPGRLTNTMVC-AGAEGRGAESCEGDSGGPLVCGG-ILQGIVSWGDVPCDNTTKPG 237

  Fly   245 VATRVSYYLTWI 256
            |.|:|.:||.||
Human   238 VYTKVCHYLEWI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 70/253 (28%)
Tryp_SPc 29..259 CDD:238113 72/254 (28%)
KLK15NP_059979.2 Tryp_SPc 25..249 CDD:214473 69/249 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.