DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and prss1

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001015792.1 Gene:prss1 / 548509 XenbaseID:XB-GENE-5776262 Length:244 Species:Xenopus tropicalis


Alignment Length:262 Identity:78/262 - (29%)
Similarity:124/262 - (47%) Gaps:41/262 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLIFGLILSAEASPQGRILGGEDVAQGEYPWSASVRYNKAHVCSGAIISTNHILTAAHCVSSVGI 76
            |::.|..::.|  ...:|:||....:...|:..|:... .|.|.|::|::..:::||||..    
 Frog     7 LVLLGAAVAFE--DDDKIVGGFTCTKNAVPYQVSLNAG-YHFCGGSLINSQWVVSAAHCYK---- 64

  Fly    77 TPVDASTLAVRLG----TINQYAGGSIVNVKSVIIHPSYG--NFLHDIAILELDETLVFSDRIQD 135
                 |.:.||||    .:|: .....:..:.||.||||.  |..:||.:::|..|...|..||.
 Frog    65 -----SRIQVRLGEHNIAVNE-GTEQFIESQKVIKHPSYNSRNLDNDIMLIKLSTTARLSSNIQS 123

  Fly   136 IALPPTTDEETEDVDAELPNGTPVYVAGWGE-LSDGTASYKQ--QKANYNTLSRSLCEWEAGYGY 197
            :.||          .|....||...::|||. ||.|| :|..  |..|...|:.|.|  ...|..
 Frog   124 VPLP----------SACASAGTNCLISGWGNTLSSGT-NYPDLLQCLNAPILTASEC--SNSYPG 175

  Fly   198 E---SVVCLS-RAEGEGICRGDAGAAVIDDDKVLRGLTSFNFGPCGSKYPDVATRVSYYLTWIEA 258
            |   ::.|.. .|.|:..|:||:|..|:.:.: |:|:.|:.:|.....||.|.|:|..|::||: 
 Frog   176 EITNNMFCAGFLAGGKDSCQGDSGGPVVCNGQ-LQGVVSWGYGCAQRNYPGVYTKVCNYVSWIQ- 238

  Fly   259 NT 260
            ||
 Frog   239 NT 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 71/240 (30%)
Tryp_SPc 29..259 CDD:238113 73/242 (30%)
prss1NP_001015792.1 Tryp_SPc 22..240 CDD:238113 73/243 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.