DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and epsilonTry

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster


Alignment Length:272 Identity:76/272 - (27%)
Similarity:137/272 - (50%) Gaps:40/272 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLIFGLILSAEAS-----------PQ--GRILGGEDVAQGEYPWSASVRYNKAHVCSGAIISTNH 63
            :|.|.::||..|.           ||  |||:||.:.:...:|:..|::...:|.|.|:|.|.:.
  Fly     1 MLKFAVLLSVLACALAGTIPDGLLPQLDGRIVGGYETSIDAHPYQVSLQRYGSHFCGGSIYSHDI 65

  Fly    64 ILTAAHCVSSVGITPVDASTLAVRLGTINQYAGGSIVNVKSVIIHPSYGN--FLHDIAILELDET 126
            ::|||||:.|     ::|..|.:|:|:....:|||:.:|:|...|..|.:  .::||||:.::..
  Fly    66 VITAAHCLQS-----IEAKDLKIRVGSTYWRSGGSVHSVRSFRNHEGYNSRTMVNDIAIIRIESD 125

  Fly   127 LVFSDRIQDIALPPTTDEETEDVDAELPNGTPVYVAGWGELSDGTASYKQQ--KANYNTLSRSLC 189
            |.|...|::|.:..:...|          |....|:|||....|.::....  ..:...:..|.|
  Fly   126 LSFRSSIREIRIADSNPRE----------GATAVVSGWGTTESGGSTIPDHLLAVDLEIIDVSRC 180

  Fly   190 EW-EAGYG---YESVVCLSRAEGEGICRGDAGAAVIDDDKVLRGLTSFNFGPCGS-KYPDVATRV 249
            .. |.|||   .::::| :.|..:..|:||:|..::..|::: |:.|:.:| ||. :||.|...|
  Fly   181 RSDEFGYGKKIKDTMLC-AYAPHKDACQGDSGGPLVSGDRLV-GVVSWGYG-CGDVRYPGVYADV 242

  Fly   250 SYYLTWIEANTQ 261
            :::..|||...:
  Fly   243 AHFHEWIERTAE 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 65/236 (28%)
Tryp_SPc 29..259 CDD:238113 67/238 (28%)
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 65/236 (28%)
Tryp_SPc 31..252 CDD:238113 67/238 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.