DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and zgc:92590

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001007055.1 Gene:zgc:92590 / 474322 ZFINID:ZDB-GENE-041024-15 Length:247 Species:Danio rerio


Alignment Length:258 Identity:75/258 - (29%)
Similarity:122/258 - (47%) Gaps:33/258 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLIFG-LILSAEASPQGRILGGEDVAQGEYPWSASVRY-NKAHVCSGAIISTNHILTAAHCVSSV 74
            :::|. |:|:...|...:|:||.:.:....||...:.| |....|..::|:....::||||.   
Zfish     3 MIVFALLVLAVACSADDKIIGGYECSPNSQPWQIYLTYDNGQRWCGASLINDRWAVSAAHCY--- 64

  Fly    75 GITPVDASTLAVRLGTIN---QYAGGSIVNVKSVIIHPSYGNFL--HDIAILELDETLVFSDRIQ 134
                :.|:.|.|.||..|   :......:..:.||.||.|.::.  :|..:::|.|..||:..:|
Zfish    65 ----LVANRLTVHLGEHNVAVEEGTEQRIKAEKVIPHPKYNDYTLDNDFMLIKLKEPAVFNQYVQ 125

  Fly   135 DIALPPTTDEETEDVDAELPNGTPVYVAGWGELSDGTASYKQ--QKANYNTLSRSLCEWEAGYGY 197
            .:  |.||...:|        |....|:|||.|.:....|..  |..|...|:|:.|  |..||:
Zfish   126 PV--PLTTSCSSE--------GEQCLVSGWGNLINTGVVYPDVLQCLNLPVLTRAQC--EGAYGW 178

  Fly   198 E---SVVCLSRAE-GEGICRGDAGAAVIDDDKVLRGLTSFNFGPCGSKYPDVATRVSYYLTWI 256
            :   ::.|....| |:..|:||:|..||.:.: |||:.|:.:|...|.||.|.|.|..|..|:
Zfish   179 QITKNMFCAGFMEGGKDACQGDSGGPVICNGE-LRGVVSWGYGCADSGYPGVYTEVCRYTDWV 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 70/239 (29%)
Tryp_SPc 29..259 CDD:238113 71/240 (30%)
zgc:92590NP_001007055.1 Tryp_SPc 20..240 CDD:214473 70/239 (29%)
Tryp_SPc 21..243 CDD:238113 71/240 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.