DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and KLK12

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_062544.1 Gene:KLK12 / 43849 HGNCID:6360 Length:254 Species:Homo sapiens


Alignment Length:263 Identity:72/263 - (27%)
Similarity:113/263 - (42%) Gaps:52/263 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LGLLIFGLI----LSAEASPQGRILGGEDVAQGEYPWSASVRYNKAHVCSGAIISTNHILTAAHC 70
            :||.||.|:    ||..|:|  :|..|.:..:...||...:....:..|.|.:|....:||||||
Human     1 MGLSIFLLLCVLGLSQAATP--KIFNGTECGRNSQPWQVGLFEGTSLRCGGVLIDHRWVLTAAHC 63

  Fly    71 VSSVGITPVDASTLAVRLG--TINQ--------YAGGSIVNVKSVIIHPSY----GNFLHDIAIL 121
                     ..|...||||  :::|        ::|.|:.       ||.|    .:..||:.:|
Human    64 ---------SGSRYWVRLGEHSLSQLDWTEQIRHSGFSVT-------HPGYLGASTSHEHDLRLL 112

  Fly   122 ELDETLVFSDRIQDIALPPTTDEETEDVDAELPNGTPVYVAGWGELSDGTASYKQ--QKANYNTL 184
            .|...:..:..:|.:.||  .|..|.        ||..:|:|||..:.....:..  |..|.:.:
Human   113 RLRLPVRVTSSVQPLPLP--NDCATA--------GTECHVSGWGITNHPRNPFPDLLQCLNLSIV 167

  Fly   185 SRSLCEW-EAGYGYESVVCLSRAEGEGICRGDAGAAVIDDDKVLRGLTSF-NFGPCGSK-YPDVA 246
            |.:.|.. ..|....::||.....|:..|:||:|..::... ||:||.|: :.||||.. .|.|.
Human   168 SHATCHGVYPGRITSNMVCAGGVPGQDACQGDSGGPLVCGG-VLQGLVSWGSVGPCGQDGIPGVY 231

  Fly   247 TRV 249
            |.:
Human   232 TYI 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 63/241 (26%)
Tryp_SPc 29..259 CDD:238113 63/240 (26%)
KLK12NP_062544.1 Tryp_SPc 21..236 CDD:214473 63/241 (26%)
Tryp_SPc 22..236 CDD:238113 63/240 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BGUI
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.