DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and CG11313

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster


Alignment Length:290 Identity:81/290 - (27%)
Similarity:127/290 - (43%) Gaps:65/290 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ILSAEASPQGRILGGE----DVAQG------EYPWSASVRYNKAH-------VCSGAIISTNHIL 65
            ::.:...|...|.||:    .:.:|      |:.|...:.| :.|       .|:|::|:..:::
  Fly    95 VIHSTLLPDRSICGGDIAYNQITKGNETVLTEFAWMVLLEY-RPHDGQQLRTYCAGSLINNRYVV 158

  Fly    66 TAAHCVSSV-----GITPVDAS-TLAVRLGTINQYAGGSIVN-----------VKSVIIHPSYGN 113
            |||||||:.     |    |.| .::||||..|..|....:|           |:.:.||.|:|.
  Fly   159 TAAHCVSAATRARKG----DVSFRVSVRLGEHNTSAVVDCLNGRCLPEPVQIAVEEIRIHESFGT 219

  Fly   114 --FLHDIAILELDETLVFSDRIQDIALPPTTDEETEDVDAELPNGTPVYVAGWGELSDGTASYKQ 176
              |.:|||::.|...:.:|..|:.:.||.|...:      ...:|....|||||......:|..:
  Fly   220 RLFWNDIALIRLAREVAYSPSIRPVCLPSTVGLQ------NWQSGQAFTVAGWGRTLTSESSPVK 278

  Fly   177 QKANYNTLSRSLCEWEAGYGYESVVCL--------SRAEGEGICRGDAGAAVI---DDDKVLRGL 230
            .|.....:...||..:    |.|:|.|        .|:.|:. |.||:|..::   :...||.|:
  Fly   279 MKLRVTYVEPGLCRRK----YASIVVLGDSHLCAEGRSRGDS-CDGDSGGPLMAFHEGVWVLGGI 338

  Fly   231 TSFNFGPCGSKY-PDVATRVSYYLTWIEAN 259
            .||... |||:: |.|.|.|..|.|||..|
  Fly   339 VSFGLN-CGSRFWPAVYTNVLSYETWITQN 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 77/275 (28%)
Tryp_SPc 29..259 CDD:238113 79/277 (29%)
CG11313NP_651821.3 CLIP 24..78 CDD:288855
Tryp_SPc 116..367 CDD:238113 76/267 (28%)
Tryp_SPc 116..364 CDD:214473 74/264 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.