DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and CG9733

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster


Alignment Length:272 Identity:74/272 - (27%)
Similarity:121/272 - (44%) Gaps:49/272 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 QGRILGGEDVAQGEYPWSASVRYNK------AHVCSGAIISTNHILTAAHCVSSVGITPVDASTL 84
            :.||..|:|....|:||...:.|.:      :..|:|::|:..::||||||::  |....:..||
  Fly   159 RNRIYDGQDTDVNEFPWMVLLEYRRRSGNGLSTACAGSLINRRYVLTAAHCLT--GRIEREVGTL 221

  Fly    85 -AVRLGTINQY-------AGGSI------VNVKSVIIHPSY----GNFLHDIAILELDETLVFSD 131
             :||||..:..       .|||.      :..:.:.:|..|    .|.:|||.::.::..:.:||
  Fly   222 VSVRLGEHDTRTAVDCPPGGGSCSPEVQRLGFEEIRVHERYSEKASNQVHDIGLIRMERNVRYSD 286

  Fly   132 RIQDIALPPTTDEETEDVDAELPNGTPVYVAGWGELSDGTASYKQQKANYNTLSRSLCEWEAGYG 196
            .||.|.||.:...|:..      :|....|||||.......|..:||...|.:..:.|...    
  Fly   287 NIQPICLPSSVGLESRQ------SGQQFTVAGWGRTLKMARSAVKQKVTVNYVDPAKCRQR---- 341

  Fly   197 YESV--------VCLSRAEGEGICRGDAGAAVI---DDDKVLRGLTSFNFGPCGSK-YPDVATRV 249
            :..:        :|......:..|.||:|..::   |:..||.|:.||.: .||.| :|.|.|.|
  Fly   342 FSQIKVNLEPTQLCAGGQFRKDSCDGDSGGPLMRFRDESWVLEGIVSFGY-KCGLKDWPGVYTNV 405

  Fly   250 SYYLTWIEANTQ 261
            :.|..||..|.:
  Fly   406 AAYDIWIRQNVR 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 71/263 (27%)
Tryp_SPc 29..259 CDD:238113 72/265 (27%)
CG9733NP_651784.2 CLIP 25..78 CDD:288855
Tryp_SPc 161..412 CDD:214473 71/263 (27%)
Tryp_SPc 162..415 CDD:238113 72/265 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.