DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9673 and aqrs

DIOPT Version :9

Sequence 1:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_651632.2 Gene:aqrs / 43396 FlyBaseID:FBgn0039598 Length:366 Species:Drosophila melanogaster


Alignment Length:175 Identity:38/175 - (21%)
Similarity:60/175 - (34%) Gaps:45/175 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 VCSGAIISTNHILTAAHCVSSVGITPVDASTLAVRLGTINQYAGGSIVNVKSVII------HPSY 111
            :|:||:||...::|:.||..            ..|...|.:|....:..:..|.:      |...
  Fly    88 ICAGALISRRMVVTSTHCFQ------------PRRFDLIYEYTAKHLSILTGVELDDNPEPHQVI 140

  Fly   112 G---------NFLHDIAILELDETLVFSDRIQDIALPPTTDEETEDVDAELPNGTPVYVAGWGEL 167
            |         .|.:.:|:|.|...| ..|:.:.|.|.....:..:||.... .|.|         
  Fly   141 GFFMPVNKNERFTNYVALLALSNKL-DRDKYRYIPLHRKKPQAGDDVKMAY-YGPP--------- 194

  Fly   168 SDGTASYKQQKANYNTLSRSLCEWEAGYGYESVVCLSRAEGEGIC 212
                   |.|...|||....:...:..||.:.|..:|..|.:.||
  Fly   195 -------KFQIRLYNTRVMDIDRCKIHYGLKEVFHVSTFEPDFIC 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 38/175 (22%)
Tryp_SPc 29..259 CDD:238113 38/175 (22%)
aqrsNP_651632.2 Trypsin 82..290 CDD:278516 38/175 (22%)
Tryp_SPc 83..268 CDD:304450 38/175 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.